KEGG   Sus scrofa (pig): 100517185Help
Entry
100517185         CDS       T01009                                 

Gene name
CDC27
Definition
cell division cycle 27
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
ssc  Sus scrofa (pig)
Pathway
Cell cycle
Oocyte meiosis
Ubiquitin mediated proteolysis
Progesterone-mediated oocyte maturation
HTLV-I infection
Module
APC/C complex
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:ssc04120]
Cellular Processes; Cell growth and death; Cell cycle [PATH:ssc04110]
Cellular Processes; Cell growth and death; Oocyte meiosis [PATH:ssc04114]
Organismal Systems; Endocrine system; Progesterone-mediated oocyte maturation [PATH:ssc04914]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:ssc05166]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
12
AA seq 825 aa AA seqDB search
MTVLQEPVQAAIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRL
LKGHSCTTPQCKYLLAKCCVDLSKLAEGEQILSGGVFNKQKSYDDIVTEFGDSACFTLSL
LGHVYCKTDRLAKGSECYQKSLSLNPFLWSPFESLCEIGEKPDPDQTFKLTSLQNFSNCL
PNSCTTLVSNHSLSHRQPETVLTETPQDTIELNRLNLESSNSKYSLNTDSSVSYIDSAVI
SPDTVPLGTGTSILSKQVQNKPKTGRSLLGGPTALSPLTPSFGILPLETPSPGDGSYLQN
YTNTSSVIDVPSTGAPSKKSVTRIGQTGTKSVFSQSGNSREVTPILVAQTQSSGPQTSTT
PQVLSPTITSPPNALPRRSSRLFTSDSSTTKENSKKLKMKFPPKIPNRKTKSKTNKGGIT
QPNINDSLEITKLDSSIISEGKISTITPQIQAFNLQKAAAEGLMSLLREMGKGYLALCSY
NCKEAINILSHLPSHHYNTGWVLCQIGRAYFELSEYMQAERIFSEVRRIENYRVEGMEIY
STTLWHLQKDVALSVLSKDLTDMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAIQVDPN
YAYAYTLLGHEFVLTEELDKALACFRNAIRVNPRHYNAWYGLGMIYYKQEKFSLAEMHFQ
KALDINPQSSVLLCHIGVVQHALKKSEKALDTLNKAIVIDPKNPLCKFHRASVLFANEKY
KSALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKGANNQIKEAI
DKRYLPDDEEPITQEEQIMGTDESQESSMTDADDTQLHAAESDEF
NT seq 2478 nt NT seq  +upstreamnt  +downstreamnt
atgacggtgctgcaggaacccgtccaggctgctatatggcaagcactaaaccactatgct
tacagagatgcagttttcctcgcagaacgactatatgcagaagtacactcagaagaagcc
ttgtttttactggcaacctgttattaccgctcaggaaaagcatataaagcatatagactc
ttgaaaggacacagttgtacaacaccgcaatgtaaatacctgcttgcaaaatgttgtgtc
gatctcagcaagcttgcagaaggggaacagatcttatctggtggagtgtttaataagcag
aaaagctatgatgacattgtaactgagtttggtgattctgcttgttttactctttcattg
ttgggacatgtatattgcaagacagatcgacttgccaaaggatcagaatgttaccaaaag
agccttagtttaaatcctttcctctggtccccctttgaatcattatgtgaaataggtgaa
aagccagatcctgaccaaacatttaagttaacatctctacagaactttagcaactgtctg
cccaactcttgcacaacactagtatctaatcatagtttatctcacagacagcctgagaca
gttcttacagaaacaccccaggacacaattgaattaaacagactgaatttagaatcttcc
aattcaaagtactccttgaatacagattcctcagtatcttatattgattcagctgtaatt
tcaccagatactgtccctcttggaacaggaacttccatattatctaaacaggttcaaaat
aaaccaaaaactggtcgaagtttgttaggaggaccaactgctcttagcccattaacccca
agttttgggattttgccattagaaaccccaagtcctggagatggatcctatttacaaaac
tacactaatacatcttctgtaattgacgtgccatccaccggagccccttcaaaaaagtct
gttaccagaatcggccaaactggaacaaagtctgtcttctcacaaagtggaaatagtcga
gaggtaaccccaattcttgttgcgcaaacacaaagttctggcccacaaacaagtacaaca
cctcaggtattgagccccactatcacatctcccccaaacgcactgcctcgaagaagttca
cgactttttactagtgacagctctacaaccaaggagaatagcaaaaaattaaaaatgaag
tttccacctaaaatcccaaacagaaaaacaaaaagtaaaactaataaaggaggaataact
caacctaacataaatgatagcttggaaatcacaaaattggactcttcgattatttcagag
gggaaaatctctacaatcacacctcagatccaggcatttaatctacagaaagcagcagca
gaaggtttgatgagccttcttcgtgaaatggggaaaggttatttagctttgtgctcgtac
aactgcaaagaagctataaatatcttgagccacctaccttctcaccactacaatactggt
tgggtactgtgccaaattggaagggcctattttgaactttcagagtacatgcaagctgaa
agaatattctcagaagttagaagaattgagaattacagagttgaaggcatggagatctat
tctacaacactttggcatcttcaaaaggatgttgctctttcagttctttcaaaagactta
acagacatggataaaaattcaccagaggcctggtgtgctgcagggaactgtttcagtttg
caacgagaacatgacattgcaattaaattcttccagagagctatccaggttgatccaaat
tatgcttatgcctataccctcttagggcatgagtttgtgttaactgaagaattagacaaa
gcattagcttgttttcgaaatgccatcagagtcaatcctagacattataatgcatggtat
ggtttaggaatgatttattacaagcaagaaaaattcagccttgcagaaatgcatttccag
aaagcacttgacatcaatcctcaaagttcagttttgctttgtcacatcggagtagttcag
catgcactgaagaaatcggagaaggctttggataccctaaataaagccattgttattgat
cccaagaaccctctatgcaaatttcacagagcttcagttttatttgcaaatgaaaaatac
aagtctgctttacaagaacttgaagaattgaaacaaattgttcccaaagaatccctcgtt
tacttcttaataggaaaggtttacaagaagttaggtcaaacgcacctcgccctgatgaat
ttctcttgggctatggatttagatcctaaaggagccaataaccagattaaagaggcaatt
gataagcgctaccttccagatgatgaggagccaataacgcaagaagaacagatcatggga
acagatgaatcccaggagagcagcatgacagatgcagatgacacacaacttcatgcagct
gaaagtgatgaattttaa

DBGET integrated database retrieval system