KEGG   Sus scrofa (pig): 100517185Help
Entry
100517185         CDS       T01009                                 

Gene name
CDC27
Definition
cell division cycle 27
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
ssc  Sus scrofa (pig)
Pathway
Cell cycle
Oocyte meiosis
Ubiquitin mediated proteolysis
Progesterone-mediated oocyte maturation
HTLV-I infection
Module
APC/C complex
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100517185 (CDC27)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    100517185 (CDC27)
   04114 Oocyte meiosis
    100517185 (CDC27)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100517185 (CDC27)
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    100517185 (CDC27)
Protein phosphatases and associated proteins [BR:ssc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     100517185 (CDC27)
Ubiquitin system [BR:ssc04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     100517185 (CDC27)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
12
AA seq 825 aa AA seqDB search
MTVLQEPVQAAIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRL
LKGHSCTTPQCKYLLAKCCVDLSKLAEGEQILSGGVFNKQKSYDDIVTEFGDSACFTLSL
LGHVYCKTDRLAKGSECYQKSLSLNPFLWSPFESLCEIGEKPDPDQTFKLTSLQNFSNCL
PNSCTTLVSNHSLSHRQPETVLTETPQDTIELNRLNLESSNSKYSLNTDSSVSYIDSAVI
SPDTVPLGTGTSILSKQVQNKPKTGRSLLGGPTALSPLTPSFGILPLETPSPGDGSYLQN
YTNTSSVIDVPSTGAPSKKSVTRIGQTGTKSVFSQSGNSREVTPILVAQTQSSGPQTSTT
PQVLSPTITSPPNALPRRSSRLFTSDSSTTKENSKKLKMKFPPKIPNRKTKSKTNKGGIT
QPNINDSLEITKLDSSIISEGKISTITPQIQAFNLQKAAAEGLMSLLREMGKGYLALCSY
NCKEAINILSHLPSHHYNTGWVLCQIGRAYFELSEYMQAERIFSEVRRIENYRVEGMEIY
STTLWHLQKDVALSVLSKDLTDMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAIQVDPN
YAYAYTLLGHEFVLTEELDKALACFRNAIRVNPRHYNAWYGLGMIYYKQEKFSLAEMHFQ
KALDINPQSSVLLCHIGVVQHALKKSEKALDTLNKAIVIDPKNPLCKFHRASVLFANEKY
KSALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKGANNQIKEAI
DKRYLPDDEEPITQEEQIMGTDESQESSMTDADDTQLHAAESDEF
NT seq 2478 nt NT seq  +upstreamnt  +downstreamnt
atgacggtgctgcaggaacccgtccaggctgctatatggcaagcactaaaccactatgct
tacagagatgcagttttcctcgcagaacgactatatgcagaagtacactcagaagaagcc
ttgtttttactggcaacctgttattaccgctcaggaaaagcatataaagcatatagactc
ttgaaaggacacagttgtacaacaccgcaatgtaaatacctgcttgcaaaatgttgtgtc
gatctcagcaagcttgcagaaggggaacagatcttatctggtggagtgtttaataagcag
aaaagctatgatgacattgtaactgagtttggtgattctgcttgttttactctttcattg
ttgggacatgtatattgcaagacagatcgacttgccaaaggatcagaatgttaccaaaag
agccttagtttaaatcctttcctctggtccccctttgaatcattatgtgaaataggtgaa
aagccagatcctgaccaaacatttaagttaacatctctacagaactttagcaactgtctg
cccaactcttgcacaacactagtatctaatcatagtttatctcacagacagcctgagaca
gttcttacagaaacaccccaggacacaattgaattaaacagactgaatttagaatcttcc
aattcaaagtactccttgaatacagattcctcagtatcttatattgattcagctgtaatt
tcaccagatactgtccctcttggaacaggaacttccatattatctaaacaggttcaaaat
aaaccaaaaactggtcgaagtttgttaggaggaccaactgctcttagcccattaacccca
agttttgggattttgccattagaaaccccaagtcctggagatggatcctatttacaaaac
tacactaatacatcttctgtaattgacgtgccatccaccggagccccttcaaaaaagtct
gttaccagaatcggccaaactggaacaaagtctgtcttctcacaaagtggaaatagtcga
gaggtaaccccaattcttgttgcgcaaacacaaagttctggcccacaaacaagtacaaca
cctcaggtattgagccccactatcacatctcccccaaacgcactgcctcgaagaagttca
cgactttttactagtgacagctctacaaccaaggagaatagcaaaaaattaaaaatgaag
tttccacctaaaatcccaaacagaaaaacaaaaagtaaaactaataaaggaggaataact
caacctaacataaatgatagcttggaaatcacaaaattggactcttcgattatttcagag
gggaaaatctctacaatcacacctcagatccaggcatttaatctacagaaagcagcagca
gaaggtttgatgagccttcttcgtgaaatggggaaaggttatttagctttgtgctcgtac
aactgcaaagaagctataaatatcttgagccacctaccttctcaccactacaatactggt
tgggtactgtgccaaattggaagggcctattttgaactttcagagtacatgcaagctgaa
agaatattctcagaagttagaagaattgagaattacagagttgaaggcatggagatctat
tctacaacactttggcatcttcaaaaggatgttgctctttcagttctttcaaaagactta
acagacatggataaaaattcaccagaggcctggtgtgctgcagggaactgtttcagtttg
caacgagaacatgacattgcaattaaattcttccagagagctatccaggttgatccaaat
tatgcttatgcctataccctcttagggcatgagtttgtgttaactgaagaattagacaaa
gcattagcttgttttcgaaatgccatcagagtcaatcctagacattataatgcatggtat
ggtttaggaatgatttattacaagcaagaaaaattcagccttgcagaaatgcatttccag
aaagcacttgacatcaatcctcaaagttcagttttgctttgtcacatcggagtagttcag
catgcactgaagaaatcggagaaggctttggataccctaaataaagccattgttattgat
cccaagaaccctctatgcaaatttcacagagcttcagttttatttgcaaatgaaaaatac
aagtctgctttacaagaacttgaagaattgaaacaaattgttcccaaagaatccctcgtt
tacttcttaataggaaaggtttacaagaagttaggtcaaacgcacctcgccctgatgaat
ttctcttgggctatggatttagatcctaaaggagccaataaccagattaaagaggcaatt
gataagcgctaccttccagatgatgaggagccaataacgcaagaagaacagatcatggga
acagatgaatcccaggagagcagcatgacagatgcagatgacacacaacttcatgcagct
gaaagtgatgaattttaa

DBGET integrated database retrieval system