KEGG   Sus scrofa (pig): 100517354Help
Entry
100517354         CDS       T01009                                 

Gene name
DCK
Definition
deoxycytidine kinase
Orthology
K00893  
deoxycitidine kinase [EC:2.7.1.74]
Organism
ssc  Sus scrofa (pig)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:ssc00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:ssc00240]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
8
AA seq 260 aa AA seqDB search
MATPPKRSCPSSPASSEGNRIKKISIEGNIAAGKSTFVNILKQVCEDWEVVPEPVARWCN
VQSTQNEFEELTTSQKSGGNVLQMMYEKPERWSFTFQSYACLSRIRAQLAALNGKLKDAE
KPVLFFERSVYSDRYIFASNLYESDCMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLRA
TPEKCLNRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNE
DFKDKHSSLVEKVKEFLSTL
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggccaccccccccaagaggagctgcccgtcttccccagccagctcagaggggaaccgc
atcaagaaaatttccattgaagggaacatcgctgcggggaagtcaacatttgtgaatatt
cttaaacaagtctgcgaggattgggaagtggttcctgaacctgttgccaggtggtgcaat
gttcagagtactcaaaatgaatttgaggaattgacaacatctcagaaaagtggcgggaat
gttcttcagatgatgtatgagaaacctgaacgatggtcttttaccttccagtcctatgcc
tgcctcagtcgaatacgagctcagcttgctgctctcaatggcaagctcaaagatgcagag
aaacctgtattattctttgaacgatctgtgtatagtgacaggtatatttttgcatctaat
ctgtatgaatctgactgcatgaatgaaacagaatggaccatttatcaagactggcatgac
tggatgaataaccagtttggccaaagccttgaactggatggaatcatttatcttcgcgcc
actccagagaaatgtttgaatagaatatatttacggggaagaaatgaagaacaaggcatt
cctcttgaatacttagagaagcttcactataagcatgaaagctggctcctgcatagaaca
ctaaaaaccaactttgattatctacaagaagtgcctatcttaacactggatgttaacgaa
gactttaaagacaaacacagcagtctggttgaaaaggtaaaagaatttttgagcactttg
tga

DBGET integrated database retrieval system