KEGG   Sus scrofa (pig): 100517557Help
Entry
100517557         CDS       T01009                                 

Gene name
CACNA2D2
Definition
(RefSeq) voltage-dependent calcium channel subunit alpha-2/delta-2 isoform X1
  KO
K04859  
voltage-dependent calcium channel alpha-2/delta-2
Organism
ssc  Sus scrofa (pig)
Pathway
MAPK signaling pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
Oxytocin signaling pathway
Hypertrophic cardiomyopathy (HCM)
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100517557 (CACNA2D2)
 Organismal Systems
  Endocrine system
   04921 Oxytocin signaling pathway
    100517557 (CACNA2D2)
  Circulatory system
   04260 Cardiac muscle contraction
    100517557 (CACNA2D2)
   04261 Adrenergic signaling in cardiomyocytes
    100517557 (CACNA2D2)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    100517557 (CACNA2D2)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    100517557 (CACNA2D2)
   05414 Dilated cardiomyopathy (DCM)
    100517557 (CACNA2D2)
Ion channels [BR:ssc04040]
 Voltage-gated cation channels
  Ca2+ channel, CACN alpha-2 delta
   100517557 (CACNA2D2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
13
AA seq 1154 aa AA seqDB search
MAVPARTCGASRPSPARTARSLPGRGPRPGPSAWRRAVGPPRPLSLLLPPLLLLPLLAAP
GASAYSFPQQHTMQHWARRLEQEIDGVMRIFGGVQQLREIYKDNRNLFEVQENEPQKLVE
KVAGDIESLLDRKVQALKRLADAAENFQKAHRWQDNIKEEDILYYDAKADAELDDPESED
VERGSKASTLRLDFVEDSNFKNKVNYSYTAVQIPTDIYKGSTIILNELNWTEALENVFIE
NRRQDPTLLWQVFGSATGVTRYYPATPWRAPKKIDLYDVRRRPWYIQGASSPKDMVIIVD
VSGSVSGLTLKLMKTSVCEMLDTLSDDDYVNVASFNEKAQPVSCFTHLVQANVRNKKVFK
EAVQGMVAKGTTGYKAGFEYAFDQLQNSNITRANCNKMIMMFTDGGEDRVQDVFEKYNWP
NRTVRVFTFSVGQHNYDVTPLQWMACANKGYYFEIPSIGAIRINTQEYLDVLGRPMVLAG
KEAKQVQWTNVYEDALGLGLVVTGTLPVFNLTQDGPGEKKNQLILGVMGIDVALNDIKRL
TPNYTLGANGYVFAIDLNGYVLLHPNLKPQTTNFREPVTLDFLDAELEDENKEEIRRSMI
DGNKGHKQIRTLVKSLDERYIDEVMRNYTWVPIRSTNYSLGLVLPPYSTFYLQANLSDQI
LQVKLPISKLKDFEFLLPSSFESEGHVFIAPREYCKDLNASDNNTEFLKNFIELMEKVTP
DSKQCNNFLLHNLILDTGITQQLVERVWRDQDLNTYSLLAVFAATDGGITRVFPNKAAED
WTENPEPFNASFYRRSLDNHGYVFKPPHQDALLRPLELENDTVGILVSTAVELSLGGRTL
RPAVVGVKLDLEAWAEKFKVLASNRTHQDQPQKQCGPSSHCEMDCEVNNEDLLCVLIDDG
GFLVLSNQNHQWDQVGRFFSEVDANLMLALYNNSFYTRKESYDYQAACAPQPPGNLGSAP
RGIFVPTIADFLNLAWWTSAAAWSLFQQLLYGIIYHSWFQADPAEAEGNPEVRESSCVMK
QTQYYFGSVNASYNAIIDCGNCSRLFHAQRLTNTNLLFVVAEKPMCSQCEAGRLLQKETH
SDGPEQCELVQRPRYRRGPHICFDYNATEDTSDCGRGASFPPSLGVLVSLQLLLLLGLPP
RPQPQVHAHASRRL
NT seq 3465 nt NT seq  +upstreamnt  +downstreamnt
atggcggtgccggctcggacctgcggcgcctctcggcccagcccggcacggaccgcgcgc
tctctgcccggccgtggcccccggcccggccccagcgcctggcgccgggcggtcgggccc
ccgcgccctctgtcgctgctactgcctccgctgctgctgctgccgctgctcgccgccccc
ggcgcctctgcctacagcttccctcagcagcacacgatgcagcactgggcccggcgcctg
gagcaggagattgatggcgtgatgaggatctttgggggcgtccagcagctccgtgagatc
tacaaagacaacaggaacctgtttgaggtgcaggagaatgagccccagaagttggtggag
aaggtggcgggggacattgagagcctgctagacaggaaggtgcaggccctgaagagattg
gccgatgctgcagagaacttccagaaagcccaccgctggcaggacaacatcaaggaggaa
gacattctgtactatgatgccaaggccgacgctgagctggacgaccctgagagtgaggat
gtggaaagggggtccaaggccagtaccctaaggctggactttgttgaggactcaaacttc
aagaacaaggtcaactattcatacacagctgtgcagatccccacggacatctacaaaggc
tccaccatcattctcaatgagctcaactggacagaagccctggagaatgtgttcattgag
aaccgcaggcaggaccccacactgctgtggcaggtctttggcagcgccacgggagtcact
cgctattatccagccaccccatggcgagcccccaagaaaatcgacctgtacgatgtccga
aggagaccctggtatatccagggggcctcatcgcccaaggacatggtcatcatcgtggat
gtgagtggcagtgtaagcggcttgaccctgaagctgatgaagacatctgtctgtgagatg
ctggacacgctctctgatgatgactatgtgaacgtggcctctttcaatgaaaaggcacag
cctgtgtcatgcttcacacacttggtacaggccaacgtgcgtaacaagaaggtgttcaag
gaagctgtgcagggcatggtggctaagggcaccacaggctacaaggccggctttgagtat
gccttcgaccagctgcaaaattccaacatcactcgtgccaactgcaataagatgatcatg
atgttcacggatggtggcgaggaccgtgtgcaggacgtctttgagaagtacaattggccc
aatcggacggttcgcgtgttcactttctccgtggggcagcacaactatgacgtcactccc
ctgcaatggatggcctgtgccaacaaaggttactattttgagatcccttccattggcgcc
atccgcatcaatacgcaggaatacctagacgtgttgggcaggcccatggtgctggcaggc
aaggaggccaagcaggtgcaatggaccaacgtgtacgaggatgcactggggttggggttg
gtggtgacagggaccctccctgttttcaacctgacacaggacggccctggggaaaagaag
aaccagctgatcctgggtgtgatgggcattgatgtggctctgaatgacatcaagaggctg
actcccaactacacgcttggagccaacggctacgtgtttgccattgacctgaatggctat
gtgttgctgcaccccaacctcaagccccagaccaccaacttccgggagcctgtgactctg
gacttcctggatgcagagctggaggatgagaacaaagaggagatccgtcggagcatgatc
gatggcaacaagggtcacaagcagatcagaaccctggtcaagtccctggatgagaggtac
atagacgaggtgatgcggaactacacctgggtgcctataaggagcaccaactacagccta
gggctagtgctcccgccctacagcaccttctacctccaagccaacctcagtgaccagatc
ctgcaggtcaagttgccaatcagcaaactgaaggattttgagttcctgctccccagcagc
tttgagtctgaaggacatgttttcattgctcccagagagtattgcaaggacctgaatgct
tcagacaacaacaccgagttcctgaaaaacttcattgagctcatggagaaagtgactcca
gactccaagcagtgcaacaacttccttctgcacaacctgatcttggacacaggcatcaca
cagcagctggtggagcgtgtgtggcgggaccaggatctcaacacgtacagccttctggcc
gtgttcgccgccactgatggcggcatcactcgtgtattccccaacaaggcagctgaggac
tggacagagaaccccgagcccttcaatgccagcttctatcgccgcagcctagacaaccat
ggctacgtcttcaagccaccgcatcaggatgccctgttaaggccactggagctggagaat
gacacggtgggcatcctggtcagcacggctgtggagctcagcctaggtggacgcacactg
agaccagcagtcgtgggcgtgaaactggacctagaggcatgggctgagaagttcaaggtg
ctagccagcaaccgtacccaccaggaccagcctcagaagcagtgcggccccagcagccac
tgtgagatggactgcgaagttaacaatgaggacctgctctgtgtcctcattgacgacggg
ggattcctggtactgtcaaaccagaaccatcagtgggaccaggtgggcaggttcttcagt
gaggtggatgccaacctgatgctggcactctacaataactccttctacacccgcaaggag
tcctatgactatcaagcggcctgtgctccccagcccccaggcaacttgggatctgcaccc
cgaggcatctttgtgcccaccattgcagacttccttaacctagcttggtggacctctgct
gcggcctggtctttgttccagcagcttctctatggcattatctaccacagctggttccag
gcagacccggcggaggccgaagggaacccggaggtgcgcgagagcagctgcgtcatgaaa
cagacccagtactacttcggttcggtgaacgcctcctacaacgccatcatcgactgcgga
aactgttccaggctcttccacgcgcagaggctgaccaacaccaaccttctcttcgtggtg
gccgagaagccgatgtgcagccagtgtgaggcaggccggctgctgcagaaggaaacacac
tcggacggcccggagcagtgtgaactggtgcagagaccacgataccggagaggcccacac
atttgcttcgactacaatgccacggaagatacttcagactgcggccgtggagcctccttc
ccgccgtcgttgggcgtcctggtgtccctgcagctgctgctcctcctaggcctgcctccc
cggccacagcctcaagtccacgcccatgcttctcgccgcctctga

DBGET integrated database retrieval system