KEGG   Sus scrofa (pig): 100518073Help
Entry
100518073         CDS       T01009                                 

Gene name
ARHGEF1
Definition
Rho guanine nucleotide exchange factor (GEF) 1
Orthology
K12330  
Rho guanine nucleotide exchange factor 1
Organism
ssc  Sus scrofa (pig)
Pathway
Vascular smooth muscle contraction
Platelet activation
Regulation of actin cytoskeleton
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100518073 (ARHGEF1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    100518073 (ARHGEF1)
  Circulatory system
   04270 Vascular smooth muscle contraction
    100518073 (ARHGEF1)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    100518073 (ARHGEF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
6
AA seq 953 aa AA seqDB search
MQGEVETLRETRWERQREMGEREREERRHVRQRLGQPCRAMEAEDVARGAAPGPPRPGLV
PVSIIGAEDEDFENELKTNPEEQSNQFQSLEQVKQRPAHLMALLQYVAMQFEPGPLLCCL
HADMLGSLGPKEAKKAFIDFYHSFLDKTAVLRVQVPPTVAFELDRTRPELISEDIQRQFV
QEVVQRQQALVSRQLEDFRSKKLMGMTPWEQELTQLGAWVGRDRASFEARERHLAERQLT
HLEEMQHTISPDEEKSAAVVNAISLYMRHLGVRTKSGDKKSGRNFFRKKVIGNRRSDEPT
KAKKGLSSFLDAARWNRTEPQAPDFRHLKVETDAEKPVLTERKGGLGVPSRDRNIGAPGQ
DTPGVSPHPLPGDSPDREPGVDALPELGDPPPQGPVSLEPPVAAESTEEGADTESPEPGD
EGEPGRSGLELEPEEPPGWRELVPLGTLHSLPKSQVKRQEVISELLVTEAAHVRMLRVLH
DLFYQPMAEGGFFLLEELQNIFPSLEELIEVHSLFLDRLMKRRQDSGYLIEEIGDVLLAQ
FDGPEGSWFQKISSRFCSRQSFALEQLKAKQRKEPRFCAFVQEAESQPRCRRLQLKDMIP
TEMQRLTKYPLLLQSIGQNTEEPAEREKVEQAAECCREILHHVNQAVRDMEDLLRLKDYQ
RRLDLSHLKQSSDPMLSEFKNLDITKKKLVHEGPLTWRVTKDKAVEVHVLLLDDLLLLLQ
RQDDRLLLKSHSRTLTPTPDGKTMLRPVLRLTSAMTREVATDHKAFYVIFTWDQEAHIYE
LVAQTVSERKNWCTLITETAGSLKVPAPTSRPKHRPSPSSSREPLLSSSENGNGGREMPP
ADGRMERIFTALLPFCRPGPEGQLAAKALQKVLSLKQLLFPLEEDSRTGPPLEGDGVPGG
SPLSPAQIQEIREELLNLEETIKHLEEVEEEFCRLRLLLSQLGENTVPQPGCT
NT seq 2862 nt NT seq  +upstreamnt  +downstreamnt
atgcagggagaagtggagactctaagggagacaagatgggagagacagcgagagatggga
gagagagagagagaggagagacggcacgtgagacagcgacttggacagccctgcagagcc
atggaggcagaagacgtcgcccgaggggcggccccggggcccccccgacccggtctggtg
cctgtcagcatcatcggggcggaggatgaggatttcgagaatgagctcaagacgaaccca
gaggagcaaagcaaccagttccagagcctggagcaggtgaagcagcggccagcccacctc
atggccctcctgcagtatgtggccatgcagttcgagccaggacccctgctctgctgcctg
cacgcggacatgctgggctcactgggccccaaggaggccaagaaggccttcatcgacttc
taccacagcttcctggacaagaccgcggttctgcgggtgcaggtccctcccaccgtggcc
tttgaacttgaccgcacccggcctgaactcatctcggaggacatccagcggcagtttgtg
caggaggtggtgcagaggcagcaggccctcgtcagccggcagctggaggactttcgctcc
aagaagctcatgggcatgacaccctgggagcaggagctgacccagctaggggcctgggtt
ggacgggaccgcgccagctttgaggcccgggagcggcacctggccgagcggcagctgacc
cacctggaggagatgcaacacaccatctctcccgatgaggaaaagagtgccgcggtggtc
aacgccatcagcctgtacatgcgccacctcggggtgcggaccaagagcggggacaagaag
tcggggagaaatttcttccggaaaaaggtgatagggaaccggcggtccgatgagccaacc
aaggccaagaaaggactgagcagcttcctggatgccgcccgctggaaccggacagagccc
caggctccagattttcgacacctcaaagtcgagactgacgctgagaagccagtccttaca
gaacggaagggaggtctaggggtgccctctcgggaccggaatatcggagcccctgggcag
gacacccccggagtttctccgcaccctctgcctggggacagccctgaccgggaaccaggt
gttgatgccctccctgaactgggggacccacccccacagggcccagtcagcctggagccc
ccagtggctgcggagagcaccgaggagggtgctgacacggagagccccgagcctggagat
gagggggagccgggccgatcgggactagagctggaaccagaggaaccgcccggctggcgg
gagctcgtgcccctgggcacactgcacagcctgcccaagagccaggtgaagcggcaggag
gtcatcagtgagctactggtgacggaggcggcccacgtgcgcatgctccgggtgctgcat
gacctcttctaccagcccatggcggaggggggcttctttctcctggaggaactgcagaac
atcttccccagcctggaagagctcatcgaggtgcattccctgttcctggatcgcctgatg
aagcggaggcaggacagtggctacctcattgaggagattggagatgtgctgttggcccag
tttgatggtcccgagggctcctggttccagaaaatctcctcccgcttctgcagccgccag
tcgtttgccttagagcagctcaaagccaaacagcgcaaggagcctcggttctgtgccttt
gttcaggaggccgagagccagccgcggtgccgccgcctgcagctgaaggacatgatcccc
acggagatgcagcgtctgaccaagtacccactgcttctgcagagcattgggcagaacaca
gaagagccggcggagcgagaaaaagtggagcaggcggcggagtgctgccgggaaattctg
caccatgtcaaccaggccgtgcgtgacatggaggacctgctgcggctcaaggactatcag
aggcggctggatttgtcccacctgaagcagagcagcgaccccatgctgagcgagttcaag
aacctggacatcaccaaaaagaagcttgtccatgagggccccctgacgtggcgggtgacg
aaggacaaagctgtggaggtccacgtgctgctgctggacgacctgctattgctgctccag
cgccaggacgatcggctgctgctcaagtcacacagccggacactgacacccacgcccgac
ggcaagaccatgctgcggccagtgctgcggctcacctctgccatgacccgtgaggtggcc
accgatcacaaagccttctatgtgatttttacctgggaccaggaggcccacatatacgag
ctggtggcacagaccgtgtcagagcggaaaaactggtgtaccctcatcactgaaaccgca
ggatccctgaaggtccctgcccccacctcccgccccaaacaccggcccagccccagcagc
agccgtgaacccctgctcagcagctctgagaatggcaacggtggccgagagatgccccca
gctgacggccggatggagaggatcttcactgccctcctgcccttctgcagaccaggccct
gagggccagcttgccgccaaggcccttcagaaagtgctgtccctgaagcagctcctgttt
cccctggaggaagacagcaggacggggcctcccctcgaaggggatggggtcccaggaggc
agcccccttagcccagcacagattcaggaaattcgggaggagctactcaacctggaggag
accattaaacatctggaggaggtggaggaggagttttgccgcctgagactcctcctgtct
cagctcggggagaacactgtcccccagcctggctgtacctga

DBGET integrated database retrieval system