KEGG   Sus scrofa (pig): 100518131Help
Entry
100518131         CDS       T01009                                 

Gene name
PIK3CD
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform isoform X1
  KO
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
ssc  Sus scrofa (pig)
Pathway
Inositol phosphate metabolism
EGFR tyrosine kinase inhibitor resistance
Endocrine resistance
Platinum drug resistance
ErbB signaling pathway
Ras signaling pathway
Rap1 signaling pathway
cAMP signaling pathway
Chemokine signaling pathway
HIF-1 signaling pathway
FoxO signaling pathway
Phosphatidylinositol signaling system
Sphingolipid signaling pathway
Phospholipase D signaling pathway
Autophagy - animal
mTOR signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Apoptosis
Longevity regulating pathway
Longevity regulating pathway - multiple species
Cellular senescence
Axon guidance
VEGF signaling pathway
Osteoclast differentiation
Focal adhesion
Signaling pathways regulating pluripotency of stem cells
Platelet activation
Toll-like receptor signaling pathway
Jak-STAT signaling pathway
Natural killer cell mediated cytotoxicity
T cell receptor signaling pathway
B cell receptor signaling pathway
Fc epsilon RI signaling pathway
Fc gamma R-mediated phagocytosis
TNF signaling pathway
Leukocyte transendothelial migration
Neurotrophin signaling pathway
Cholinergic synapse
Inflammatory mediator regulation of TRP channels
Regulation of actin cytoskeleton
Insulin signaling pathway
Progesterone-mediated oocyte maturation
Estrogen signaling pathway
Prolactin signaling pathway
Thyroid hormone signaling pathway
Regulation of lipolysis in adipocytes
Relaxin signaling pathway
Type II diabetes mellitus
Insulin resistance
Non-alcoholic fatty liver disease (NAFLD)
AGE-RAGE signaling pathway in diabetic complications
Aldosterone-regulated sodium reabsorption
Carbohydrate digestion and absorption
Bacterial invasion of epithelial cells
Chagas disease (American trypanosomiasis)
Amoebiasis
Hepatitis C
Hepatitis B
Measles
Influenza A
Human papillomavirus infection
HTLV-I infection
Kaposi's sarcoma-associated herpesvirus infection
Epstein-Barr virus infection
Pathways in cancer
Viral carcinogenesis
Proteoglycans in cancer
Colorectal cancer
Renal cell carcinoma
Pancreatic cancer
Endometrial cancer
Glioma
Prostate cancer
Melanoma
Chronic myeloid leukemia
Acute myeloid leukemia
Small cell lung cancer
Non-small cell lung cancer
Breast cancer
Hepatocellular carcinoma
Gastric cancer
Central carbon metabolism in cancer
Choline metabolism in cancer
Fluid shear stress and atherosclerosis
Module
PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100518131 (PIK3CD)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100518131 (PIK3CD)
   04015 Rap1 signaling pathway
    100518131 (PIK3CD)
   04012 ErbB signaling pathway
    100518131 (PIK3CD)
   04370 VEGF signaling pathway
    100518131 (PIK3CD)
   04630 Jak-STAT signaling pathway
    100518131 (PIK3CD)
   04668 TNF signaling pathway
    100518131 (PIK3CD)
   04066 HIF-1 signaling pathway
    100518131 (PIK3CD)
   04068 FoxO signaling pathway
    100518131 (PIK3CD)
   04070 Phosphatidylinositol signaling system
    100518131 (PIK3CD)
   04072 Phospholipase D signaling pathway
    100518131 (PIK3CD)
   04071 Sphingolipid signaling pathway
    100518131 (PIK3CD)
   04024 cAMP signaling pathway
    100518131 (PIK3CD)
   04151 PI3K-Akt signaling pathway
    100518131 (PIK3CD)
   04152 AMPK signaling pathway
    100518131 (PIK3CD)
   04150 mTOR signaling pathway
    100518131 (PIK3CD)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    100518131 (PIK3CD)
  Cell growth and death
   04210 Apoptosis
    100518131 (PIK3CD)
   04218 Cellular senescence
    100518131 (PIK3CD)
  Cellular community - eukaryotes
   04510 Focal adhesion
    100518131 (PIK3CD)
   04550 Signaling pathways regulating pluripotency of stem cells
    100518131 (PIK3CD)
  Cell motility
   04810 Regulation of actin cytoskeleton
    100518131 (PIK3CD)
 Organismal Systems
  Immune system
   04611 Platelet activation
    100518131 (PIK3CD)
   04620 Toll-like receptor signaling pathway
    100518131 (PIK3CD)
   04650 Natural killer cell mediated cytotoxicity
    100518131 (PIK3CD)
   04660 T cell receptor signaling pathway
    100518131 (PIK3CD)
   04662 B cell receptor signaling pathway
    100518131 (PIK3CD)
   04664 Fc epsilon RI signaling pathway
    100518131 (PIK3CD)
   04666 Fc gamma R-mediated phagocytosis
    100518131 (PIK3CD)
   04670 Leukocyte transendothelial migration
    100518131 (PIK3CD)
   04062 Chemokine signaling pathway
    100518131 (PIK3CD)
  Endocrine system
   04910 Insulin signaling pathway
    100518131 (PIK3CD)
   04923 Regulation of lipolysis in adipocyte
    100518131 (PIK3CD)
   04915 Estrogen signaling pathway
    100518131 (PIK3CD)
   04914 Progesterone-mediated oocyte maturation
    100518131 (PIK3CD)
   04917 Prolactin signaling pathway
    100518131 (PIK3CD)
   04926 Relaxin signaling pathway
    100518131 (PIK3CD)
   04919 Thyroid hormone signaling pathway
    100518131 (PIK3CD)
  Digestive system
   04973 Carbohydrate digestion and absorption
    100518131 (PIK3CD)
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100518131 (PIK3CD)
  Nervous system
   04725 Cholinergic synapse
    100518131 (PIK3CD)
   04722 Neurotrophin signaling pathway
    100518131 (PIK3CD)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100518131 (PIK3CD)
  Development
   04360 Axon guidance
    100518131 (PIK3CD)
   04380 Osteoclast differentiation
    100518131 (PIK3CD)
  Aging
   04211 Longevity regulating pathway - mammal
    100518131 (PIK3CD)
   04213 Longevity regulating pathway - multiple species
    100518131 (PIK3CD)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100518131 (PIK3CD)
   05230 Central carbon metabolism in cancer
    100518131 (PIK3CD)
   05231 Choline metabolism in cancer
    100518131 (PIK3CD)
   05205 Proteoglycans in cancer
    100518131 (PIK3CD)
   05203 Viral carcinogenesis
    100518131 (PIK3CD)
   05210 Colorectal cancer
    100518131 (PIK3CD)
   05212 Pancreatic cancer
    100518131 (PIK3CD)
   05225 Hepatocellular carcinoma
    100518131 (PIK3CD)
   05226 Gastric cancer
    100518131 (PIK3CD)
   05214 Glioma
    100518131 (PIK3CD)
   05221 Acute myeloid leukemia
    100518131 (PIK3CD)
   05220 Chronic myeloid leukemia
    100518131 (PIK3CD)
   05218 Melanoma
    100518131 (PIK3CD)
   05211 Renal cell carcinoma
    100518131 (PIK3CD)
   05215 Prostate cancer
    100518131 (PIK3CD)
   05213 Endometrial cancer
    100518131 (PIK3CD)
   05224 Breast cancer
    100518131 (PIK3CD)
   05222 Small cell lung cancer
    100518131 (PIK3CD)
   05223 Non-small cell lung cancer
    100518131 (PIK3CD)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    100518131 (PIK3CD)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    100518131 (PIK3CD)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100518131 (PIK3CD)
   04931 Insulin resistance
    100518131 (PIK3CD)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100518131 (PIK3CD)
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    100518131 (PIK3CD)
   05166 HTLV-I infection
    100518131 (PIK3CD)
   05162 Measles
    100518131 (PIK3CD)
   05164 Influenza A
    100518131 (PIK3CD)
   05161 Hepatitis B
    100518131 (PIK3CD)
   05160 Hepatitis C
    100518131 (PIK3CD)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    100518131 (PIK3CD)
   05169 Epstein-Barr virus infection
    100518131 (PIK3CD)
   05165 Human papillomavirus infection
    100518131 (PIK3CD)
   05146 Amoebiasis
    100518131 (PIK3CD)
   05142 Chagas disease (American trypanosomiasis)
    100518131 (PIK3CD)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    100518131 (PIK3CD)
   01524 Platinum drug resistance
    100518131 (PIK3CD)
   01522 Endocrine resistance
    100518131 (PIK3CD)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     100518131 (PIK3CD)
Membrane trafficking [BR:ssc04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100518131 (PIK3CD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Vega: 
UniProt: 
Position
6
AA seq 1044 aa AA seqDB search
MPPGVDCPMEFWTKEENQSVDVDFLLPTGVYLNFPVSRNANLSTIKKVLWHRAQYEPLFH
MLSDPEAYVFTCVNQTAEQQELEDEQRRLCDIQPFLPVLRLVAREGDRVKKLINSQISLL
IGKGLHEFDSLHDPEVNDFRAKMRQFCEEAAARRQQLGWEAWLQYSFPLQLEPSARSWGP
GTLRVPNRALLVNVKFEGSEESFTFQVSTKDVPLALMACALRKKATVFRQPLVEQPEDYT
LQVNGKHEYLYGSYPLCQFQYICSCLHSGLTPHLTMVHSSSILAMRDEQSNPAPQVQKPR
TKPPPIPMKKPSSVSLWSLEQPFCIELIQGSKVNADERMKLVVQAGLFHGNETLCKTVSS
SEVSVCSDPVWKQRLEFDINVCDLPRMARLCFALYAVIEKAKKARSTKKKSKKADCPIAW
ANLMLFDYKDQLKTGERCLYMWPSVPDEKGELLNPAGTVRSNPNTESAAALVIFLPEVAP
HPVYYPSLDKILELGRHGEHGRFTEEEQLQLREILERRGSGELYEHEKDLVWKMRHEVQE
HFPEALARLLLVTKWNRHEDVAQMLYLLCSWPELPVLSALELLDFSFPDRHVGSFAIKSL
RKLTDDELFQYLLQLVQVLKYESYLDCELTKFLLDRALANRKIGHFLFWHLRSEMHVPSV
ALRFGLIMEAYCRGSTHHMKVLMKQGEALSKLKALNDVVKVSSQKTTKPQTKELMHLCMR
QETYLEALSHLQSPLDPSILLAEVCVEQCTFMDSKMKPLWVMYSNEEAGSDGSVGIIFKN
GDDLRQDMLTLQMIQLMDVLWKQEGLDLRMTPYGCLSTGDRTGLIEVVLHSDTIANIQLN
KSNMAATAAFNKDALLNWLKSKNPGEALDRAIEEFTLSCAGYCVATYVLGIGDRHSDNIM
IRENGQLFHIDFGHFLGNFKTKFGINRERVPFILTYDFVHVIQQGKTNNSEKFERFRGYC
ERAYAILRRHGLLFLHLFALMRAAGLPELSCSKDIQYLKDSLALGKTEEEALKHFRVKFN
EALRESWKTKVNWLAHNVSKDNRQ
NT seq 3135 nt NT seq  +upstreamnt  +downstreamnt
atgcccccaggggttgactgccccatggaattctggaccaaggaggagaatcagagcgta
gacgtggactttttgctgcccacgggggtctacctgaacttccctgtgtcccgaaatgcc
aacctcagcaccatcaagaaggtgttgtggcaccgagcccagtatgagccgctcttccac
atgctcagcgaccccgaggcctacgtgttcacctgcgtcaaccagactgcggagcagcag
gagctggaggacgagcagcggcggctgtgcgacatccagcccttcctgccggtcctgcgc
ctggtggcccgcgagggtgacagggtgaagaagctcatcaactcgcaaatcagcctgctc
ataggcaaagggctccacgagttcgactccttgcacgacccggaggtgaatgactttcga
gccaaaatgcgccagttctgcgaggaggcggccgcccgccggcagcagctgggctgggag
gcctggctgcagtacagcttcccgctgcagctggagccctccgcgcggagctgggggccc
ggcaccctgcgcgtccccaaccgtgccctcctggtcaacgtcaagttcgagggcagtgag
gagagcttcaccttccaggtatctaccaaggatgtgcccctggccctgatggcctgtgcc
ctgcggaagaaggccacggtgttccggcagccgctggtggagcagcccgaagactacacg
ctgcaggtgaacggcaagcatgagtacctgtatggcagctacccgctctgccagttccag
tacatctgcagctgcctgcacagcgggctgacgccccacctgaccatggtgcactcctcc
tccatcctcgccatgcgggacgaacagagcaaccccgccccccaagtccaaaagccccgc
accaaaccgccccccattcccatgaagaagccctcctccgtgtccctgtggtccctggag
cagcccttctgcatcgagctgatccagggcagcaaagtgaatgccgacgagcggatgaag
ctggtggtgcaggccgggctgtttcatggcaacgagacgctgtgcaagacggtgtccagc
tcggaggtgagcgtgtgctcggacccagtttggaagcagcggctggagttcgacatcaat
gtctgcgacctgccgcgcatggcccgcctctgcttcgccctctatgccgtgattgagaag
gccaagaaggctcgttccaccaagaagaagtccaagaaggcggactgccccatcgcctgg
gccaacctcatgctgtttgactacaaggaccagctcaagacaggcgagcgctgcctctat
atgtggccctcggtcccagatgagaaaggcgagctactgaaccccgcggggaccgtgcgg
agtaaccccaacactgagagcgcggctgccctggtcatctttctgcccgaggtggccccg
caccctgtgtactacccttccctggacaagatcctggagctggggcggcatggagagcac
gggcgcttcacggaggaggagcaactgcagctgcgggagatcctggagcggcgggggtcc
ggggagctgtacgagcacgagaaggacctggtgtggaagatgcggcacgaggtccaggag
cacttccccgaggcactggcccggctgctgctggtcaccaagtggaacaggcacgaggac
gtggcccagatgctctatctgctgtgctcctggcccgagctgcccgtcctgagtgccctg
gagctgctggacttcagcttccctgaccgccacgtgggctccttcgccatcaagtccctg
cggaaactgacggacgatgagcttttccaatacctgctgcagctggtgcaggtgctcaag
tacgagtcctacctcgactgcgagctgaccaaattcctgctggaccgggccctggccaat
cgcaagatcggccacttcctcttctggcacctccgctccgagatgcacgtgccgtcggtg
gccctgcgcttcggcctcatcatggaggcctactgcaggggcagcacccaccacatgaag
gtgctgatgaagcagggggaagcgctgagcaagctgaaggccctgaacgacgtcgtcaag
gtgagctcccagaagaccacgaagccccagaccaaggagctgatgcacctgtgcatgcgc
caggagacctacctggaggccctctcccacctgcagtccccgcttgaccccagcatcctg
ctggctgaagtctgcgtggagcagtgcacgttcatggactccaagatgaagccgctgtgg
gtcatgtacagcaacgaggaggcaggcagtgacggcagcgtgggcatcatctttaagaac
ggggacgacctccggcaggacatgctgaccttgcagatgatccagctcatggatgttctg
tggaagcaggaggggctggacctgaggatgactccctacggctgcctctccaccggggac
cgcacaggcctcatcgaggtggtgctccactcggacaccattgccaacatccagctgaac
aagagcaacatggcggccacggcggccttcaacaaggatgctctgctcaactggctcaag
tccaagaaccccggggaggccctggatcgagccatcgaggagttcaccctgtcctgcgct
ggctactgcgtggccacgtacgtgctgggcatcggggatcggcacagcgacaacatcatg
atccgcgagaacgggcagctgttccacattgatttcggccacttcctgggaaatttcaaa
accaagtttggaatcaaccgtgagcgagtcccgttcatccttacctatgactttgtccac
gtgatccagcaggggaagacgaataatagtgagaaatttgaaaggttccggggctactgt
gaacgagcctatgccatcctgcggcgccacgggctgctcttcctccacctcttcgccctg
atgcgggcagcaggcctgcctgagctcagctgctccaaagacatccagtacctcaaggac
tctctggccttggggaaaacggaggaggaggcgctaaagcacttccgggtgaagtttaac
gaagccctccgggagagctggaaaaccaaagtgaactggctggcccacaacgtgtccaaa
gataacaggcagtag

DBGET integrated database retrieval system