KEGG   Sus scrofa (pig): 100518394Help
Entry
100518394         CDS       T01009                                 

Gene name
EZH1
Definition
enhancer of zeste homolog 1 (Drosophila)
Orthology
K17451  
histone-lysine N-methyltransferase EZH1 [EC:2.1.1.43]
Organism
ssc  Sus scrofa (pig)
Brite
Enzymes [BR:ssc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100518394 (EZH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
12
AA seq 751 aa AA seqDB search
MDIQNPPTSKCITYWKRKVKSEYMRLRQLKRLQANMGAKALYVANFAKVQEKTQILNEEW
KKLRVQPVQLMKPVSGHPFLKKCTIESIFPGFASQHMLMRSLNTVALVPIMYSWSPLQQN
FMVEDETVLCNIPYMGDEVKEEDETFIEELINNYDGKVHGEEEMIPGSVLISDAVFLELV
DALNQYSDEEEDGHNDNSDGKQDDSKEDLPVTRKRKRHAIEGNKKSSKKQFPNDMIFSAI
ASMFPENGVPDDMKERYRELTEMSDPNALPPQCTPNIDGPNAKSVQREQSLHSFHTLFCR
RCFKYDCFLHPFHATPNVYKRKNKEIKIEPEPCGTDCFLLLEGAKEYAMLHNPRSKCSGR
RRRRHHVVSASCSNTSASAVAETKEGDSDRDTGNDWASSSSEANSRCQTPTKQKASPAPP
QLCVVEAPSEPVEWTGAEESLFRVFHGTYFNNFCSIARLLGTKTCKQVFQFAVKESLILK
LPTDELMNPSQKKKRKHRIWHCRELCLSCVFFPFPDNSSTQVYNYQPCDHPDRPCDSTCP
CIMTQNFCEKFCQCNPDCQNRFPGCRCKTQCNTKQCPCYLAVRECDPDLCLTCGASEHWD
CKVVSCKNCSIQRGLKKHLLLAPSDVAGWGTFIKESVQKNEFISEYCGELISQDEADRRG
KVYDKYMSSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVVMVNGDHRIGIFAKRA
IQAGEELFFDYRYSQADALKYVGIERETDVL
NT seq 2256 nt NT seq  +upstreamnt  +downstreamnt
atggatatacaaaatcccccaacttccaaatgtatcacatactggaagagaaaagttaaa
tctgaatacatgcgacttcggcagcttaaacggcttcaggcaaatatgggtgcaaaggct
ctatatgtagcaaattttgcaaaagttcaagaaaaaacccagatcctcaatgaagaatgg
aagaagcttcgtgtccaacctgttcagttgatgaagcccgtgagtgggcatccttttctc
aaaaagtgtaccatagagagcattttcccgggatttgcaagccagcatatgttaatgagg
tctctgaacacagttgcattggttcccatcatgtattcctggtcccctcttcagcagaac
tttatggtagaagatgagaccgttttgtgcaatattccctacatgggcgatgaggtgaag
gaagaagatgagactttcattgaggagctgatcaataactacgatggcaaagtccatggt
gaagaagagatgattcctggctctgtgctgattagtgatgctgttttcctggagttggta
gatgctctgaatcaatactcggatgaggaggaggacgggcacaatgacaactcagatgga
aagcaagatgacagcaaagaagatctgccagtaacgagaaagcgaaaacgacatgctatt
gaaggcaacaaaaagagttccaagaagcagtttccaaacgacatgatcttcagtgcgatc
gcctccatgttccctgagaacggcgtcccggatgacatgaaggagaggtatcgagaactc
acagagatgtcagaccccaacgctcttccccctcagtgcacccccaacatcgatggcccc
aatgccaagtccgtgcagcgggagcagtctctgcactccttccacacacttttctgccgg
cgctgctttaaatacgactgcttccttcatccttttcatgccacccctaatgtatataaa
cgcaagaacaaagaaatcaagattgagccagagccatgtggcacagactgcttccttttg
ctggaaggagcaaaggagtacgccatgctccacaaccctcgctccaagtgctcagggcgt
cgccggcgaaggcaccacgtggtcagcgcttcctgctccaacacttcagcctctgctgtg
gctgagactaaagaaggggacagtgacagggacactggcaatgactgggcctccagttct
tcagaggctaattctcgctgtcagacccccacaaagcagaaggctagtccagccccacct
cagctctgcgtagtggaagcgccctcagagcccgtggagtggaccggggctgaagaatct
ctttttcgagtcttccatggcacctacttcaacaacttctgttcgatagctaggcttctg
gggactaagacatgcaagcaggtcttccagttcgcagtgaaagaatcacttatcctgaag
ctgccaacagatgagctcatgaacccctcgcagaagaagaagagaaagcacaggatctgg
cattgccgtgagctgtgcttgtcctgtgtcttctttcctttcccagataactcctccacc
caagtgtacaactaccaaccgtgcgaccacccggaccgcccctgtgacagcacctgtccc
tgcatcatgactcagaatttctgtgagaagttctgccagtgcaaccctgactgtcagaat
cgctttcctggctgtcgctgtaagacccagtgcaataccaagcagtgcccatgctacctg
gcggtgcgagagtgtgaccccgacctgtgtctcacctgtggtgcctcagagcactgggac
tgcaaggtggtttcctgtaagaactgcagcatccagcgcggcctcaagaagcacctgctg
ctggccccctcagatgtggccggatggggcaccttcatcaaggagtctgtgcagaagaat
gaattcatttctgaatactgtggtgagctcatctctcaggatgaggctgatcgacgaggg
aaggtctatgacaagtacatgtccagcttcctcttcaacctcaacaatgattttgtggtg
gatgctacccggaaaggaaacaaaattcgatttgcaaaccactcagtgaaccccaactgt
tatgccaaagtggtcatggtgaatggggatcatcggattgggatctttgccaagagggca
attcaagctggcgaagagctcttctttgattacaggtacagccaagctgatgccctcaag
tacgtggggatcgagagggagaccgatgtcctttag

DBGET integrated database retrieval system