KEGG   Sus scrofa (pig): 100518500Help
Entry
100518500         CDS       T01009                                 

Definition
olfactory receptor 51V1-like
Orthology
K04257  
olfactory receptor
Organism
ssc  Sus scrofa (pig)
Pathway
Olfactory transduction
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    100518500
G protein-coupled receptors [BR:ssc04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    100518500
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
9
AA seq 314 aa AA seqDB search
MPAISVFNVNSSRFILTGFPGLEGDYFWLSIPFSSIYATVFLGNCMVLHVIRTEPSLHQP
MFYFLAMLAVTDLCVGLSTVHTVLGVLWGLSREVSLDACIAQSYFIHGLSFVESSVLLAM
AFDRYVAICNPLRYSSILTNDKVMKIGVAILCRSSLLIPPVIIRLKFLNYCRPHVLSHSF
CLHQDLIRMACSDIRFNSVYGLALVISNLLLDAVLIILSYLRILRAILAAASREGRSKSL
QTCGSHLCAVLVFYIPVIGLTMVHRFGRHLSPVVHVLMGNVYILFPPLMNPIIYSIRTQQ
IRRRVQRLFSLKGM
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgcctgctatctcagtcttcaacgtcaatagctccagatttattctcactggatttcct
ggcctagagggtgactacttctggctctccatccctttctcctccatctatgccacggtt
ttcctggggaactgcatggtgctgcatgtgatccggacggagcccagcctgcaccagccc
atgttctacttcctggccatgctggccgtcacggacctgtgtgtggggctgtccaccgtg
cacacggtgctgggggtcctgtgggggctcagccgggaggtcagcctggatgcctgcatc
gcccagtcctacttcatccacggcctgtccttcgtggagtcctccgtccttcttgccatg
gcctttgaccgctacgttgccatttgcaacccactacgctactcctccatcctaactaat
gacaaagtcatgaaaattggggtggcgatcctatgtaggagttccttactcatacctcca
gttatcattcgcctcaagttcttaaactactgccgtccccacgtcctctcccactccttc
tgcctgcaccaggacttaattcgaatggcctgctcggacatccgcttcaacagcgtctac
ggcctggccctggtgatcagcaacctgctgctggatgcggtgctcatcatcctctcctac
ctcaggatcctgcgtgccatcctggctgccgcatcacgagaagggaggagcaagtccttg
cagacctgtgggtctcacctctgcgccgtcctggttttctacatccccgtcattggtctg
acgatggtgcaccgcttcgggagacacctctcgcccgtggtccacgtcctcatgggcaac
gtctacatccttttcccgcccttgatgaaccccatcatctacagcatcaggacccagcag
atacggaggcgagtccagaggctgttttccttgaaaggaatgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system