KEGG   Sus scrofa (pig): 100518663Help
Entry
100518663         CDS       T01009                                 

Gene name
PLCG2
Definition
phospholipase C, gamma 2 (phosphatidylinositol-specific)
Orthology
K05859  
phosphatidylinositol phospholipase C, gamma-2 [EC:3.1.4.11]
Organism
ssc  Sus scrofa (pig)
Pathway
Inositol phosphate metabolism
Metabolic pathways
ErbB signaling pathway
Ras signaling pathway
Calcium signaling pathway
NF-kappa B signaling pathway
HIF-1 signaling pathway
Phosphatidylinositol signaling system
VEGF signaling pathway
Osteoclast differentiation
Natural killer cell mediated cytotoxicity
B cell receptor signaling pathway
Fc epsilon RI signaling pathway
Fc gamma R-mediated phagocytosis
Leukocyte transendothelial migration
Neurotrophin signaling pathway
Inflammatory mediator regulation of TRP channels
Thyroid hormone signaling pathway
Epstein-Barr virus infection
Pathways in cancer
Proteoglycans in cancer
MicroRNAs in cancer
Glioma
Non-small cell lung cancer
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:ssc00562]
Environmental Information Processing; Signal transduction; Ras signaling pathway [PATH:ssc04014]
Environmental Information Processing; Signal transduction; ErbB signaling pathway [PATH:ssc04012]
Environmental Information Processing; Signal transduction; VEGF signaling pathway [PATH:ssc04370]
Environmental Information Processing; Signal transduction; NF-kappa B signaling pathway [PATH:ssc04064]
Environmental Information Processing; Signal transduction; HIF-1 signaling pathway [PATH:ssc04066]
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:ssc04020]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:ssc04070]
Organismal Systems; Immune system; Natural killer cell mediated cytotoxicity [PATH:ssc04650]
Organismal Systems; Immune system; B cell receptor signaling pathway [PATH:ssc04662]
Organismal Systems; Immune system; Fc epsilon RI signaling pathway [PATH:ssc04664]
Organismal Systems; Immune system; Fc gamma R-mediated phagocytosis [PATH:ssc04666]
Organismal Systems; Immune system; Leukocyte transendothelial migration [PATH:ssc04670]
Organismal Systems; Endocrine system; Thyroid hormone signaling pathway [PATH:ssc04919]
Organismal Systems; Nervous system; Neurotrophin signaling pathway [PATH:ssc04722]
Organismal Systems; Sensory system; Inflammatory mediator regulation of TRP channels [PATH:ssc04750]
Organismal Systems; Development; Osteoclast differentiation [PATH:ssc04380]
Human Diseases; Cancers; Pathways in cancer [PATH:ssc05200]
Human Diseases; Cancers; MicroRNAs in cancer [PATH:ssc05206]
Human Diseases; Cancers; Proteoglycans in cancer [PATH:ssc05205]
Human Diseases; Cancers; Glioma [PATH:ssc05214]
Human Diseases; Cancers; Non-small cell lung cancer [PATH:ssc05223]
Human Diseases; Infectious diseases; Epstein-Barr virus infection [PATH:ssc05169]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
6
AA seq 1078 aa AA seqDB search
MVVVLMVLVVLMCQPPLLLSPNPALAMLFVDAIGLVCSISLRELKAILPLVNFKASSAKF
LKDKFLEIGAHKDELSFEQFHLFYKKLMFEQQKSILDEFKKDSSVFILGNTDRPDASAVH
LHDFQRFLLHEQQELWAQDLNKVRERMTKFIDDTMRETAEPFLFVDEFLTYLFSRENSIW
DEKYDVVDMQDMNNPLSHYWISSSHNTYLTGDQLRSESSTEAYIRCLRMGCRCIELDCWD
GPDGKPIIYHGWTRTTKIKFDDVVQAIKDHAFVTSSFPVILSIEEHCCVEQQRHMARVFK
EVFGDLLLTKPTEASADQLPSPSQLREKIIIKHKKLGPRGDVDVNMEDKKDEHKQQGELY
MWDSIDQKWTRHYCAIADAKLSFSDDIEQTVEEEPPVNTPPTELHFGEKWFHKKVEKRTS
AEKLLQEYCAETGGKDGTFLVRESETYPNDYTLSFWRSGRVQHCRIRSTMEGGVMKYYLT
DNLMFTSIYALIQHYRETHLRCAEFELRLTDPVPNPNPHESKPWYYDGLSRGEAEDMLMR
VPRDGAFLIRRREGTDSYAITFRARGKVKHCRINRDGRHFVLGTSAYFESLVELVSYYEK
HALYRKMRLRYPVTPELLERYNMERDINSLYDVSRMYVDPSEINPSMPQRTVKALYDYRA
KQSDELSFCRGALIHNVSKEPGGWWKGDYGTRIQQYFPSNYVEDISAVDVEELEKQIIED
NPLGSLCRGILDLNTYNVVKAPQGKNQKPFVFILEPKKQGDPPVEFATDRVEELFEWFQS
IREITWKIDTKENNMRYWEKNQSIAIELSDLVVYCKPTSKTKDNLENPDFREIRSFVETK
ADSVTRQKPNDLLKYNQKALTRIYPKGQRVDSSNYDPFRLWLCGSQMVALNFQTADKYMQ
MNHALFSLNGRTGYVLQPESMRAEKYDPMPPESQRKILMTLTVKVLGARHLPKTGRSIVC
PFVEVEICGAEYDNNKFKTTVVNDNGLSPVWAPTQEKVTFEIYDPNLAFLRFVVYEEDIF
SDPNFLAHATYPIKGIKSGYRSVPLKNGYSEDIELASLLVFCEMRPVLVSGGTPAGVP
NT seq 3237 nt NT seq  +upstreamnt  +downstreamnt
atggtggtggtgctgatggtgctggtggtgctgatgtgccagccccctctgctcctctcc
cccaaccctgccctggccatgctctttgtggatgccatagggctggtttgcagcatcagc
ctccgagagctgaaggccatcctgccgctggtcaacttcaaagcgagcagcgccaagttc
ctcaaagacaagtttctggaaattggcgcacacaaagatgaactcagctttgagcagttc
catctcttctataaaaaacttatgtttgaacagcaaaaatcgattctcgacgaattcaaa
aaggactcctccgtattcatcttgggcaacactgaccggccggacgcctctgctgtccac
ctgcacgacttccagcggtttctcttacatgagcagcaggaactttgggctcaggatctg
aacaaagtccgtgagcggatgaccaagtttatcgacgacaccatgagggaaactgccgag
cctttcttgtttgtggatgagttcctcacgtacctgttttcccgggagaacagcatttgg
gacgagaagtacgacgtggtggacatgcaggacatgaacaaccccttgtctcattactgg
atctcctcgtcccacaacacgtacctcacaggtgaccagctgcggagcgagtcgtccaca
gaggcgtacatccgctgtctgcggatgggctgccgctgcatcgagctggactgctgggac
gggcccgacgggaagcccatcatctaccacggctggacgcggaccaccaagatcaagttt
gacgatgtggtgcaggccatcaaagaccatgccttcgtcacctccagcttccccgtgatc
ctgtccatcgaggagcactgctgcgtggagcagcagcgccacatggccagggtgttcaag
gaggtgtttggggacctgctgctgacgaagcccacggaggccagtgccgaccagctgccc
tcgcccagccagctgcgggagaagatcatcatcaagcataagaagctgggcccccgaggc
gacgtggatgtcaacatggaggacaagaaagatgagcacaagcagcagggcgagctgtac
atgtgggattccatcgaccagaaatggacccggcactactgcgccattgctgatgccaag
ctgtccttcagcgatgacattgaacagactgtggaggaggaaccgcccgtgaacacgccc
cccacggagctgcattttggggagaagtggttccacaagaaggtggagaagaggacaagt
gccgagaagctgctgcaggagtactgtgccgagacagggggcaaggatgggaccttcttg
gtgcgggagagcgagacctaccccaacgactacaccctgtccttctggcggtcaggccga
gtgcagcactgccgcatccgctccaccatggagggcggggtcatgaagtactacctgact
gacaacctcatgttcaccagcatctacgccctcatccagcactaccgcgagacgcacctg
cgctgtgccgagttcgagctccggctgaccgaccccgtgcccaaccccaacccgcacgag
tcgaagccgtggtactatgacgggctgagccgcggagaagcggaggacatgctgatgagg
gttccccgggatggggccttcctcatccggaggcgggaaggtaccgactcctacgccatc
accttcagggccaggggcaaggtgaagcactgccgaatcaaccgggatggccggcacttc
gtgctgggcacctccgcctactttgagagcctcgtggagctggtcagctactacgagaag
cacgcgctctaccggaagatgagactgcgctaccctgtgacccccgagctcctggagcgc
tacaatatggaaagagatatcaactccctctatgacgtcagcagaatgtatgtggatccc
agtgaaatcaacccttccatgcctcagagaaccgtgaaagcgctgtatgactacagagcc
aagcaaagcgatgagctgagcttctgccgtggcgccctcatccataatgtctccaaggag
ccggggggctggtggaaaggagactacggaaccagaatccagcagtacttcccgtccaat
tacgtcgaggacatttcagccgttgatgtggaggagctggagaagcagattattgaagac
aatcccttagggtctctttgcagaggaatcctggatctcaacacctataatgtggtgaaa
gccccccaggggaaaaaccagaagcctttcgtctttatcttggagcccaagaagcagggc
gacccgccggtggagtttgccacggacagggtggaggagctctttgagtggtttcagagc
atccgggagatcacctggaagatagacaccaaggagaacaacatgaggtactgggagaag
aaccagtccatcgccatcgagctctcggacctggtcgtctactgcaaacccaccagcaag
accaaggacaacttagaaaaccccgacttccgagaaatccgctcctttgtggaaacgaag
gctgacagcgtcaccagacagaaacccaatgacctcctcaaatacaatcaaaaggctctg
acccgcatctaccccaagggacagcgggttgactcctccaactacgaccccttccgcctc
tggctgtgtggctcccagatggtggcactcaatttccagaccgcagataagtacatgcag
atgaaccacgctctgttttccctcaacggacggacgggttacgtcctgcagcccgagagc
atgagggccgagaagtacgaccccatgccgcccgagtcgcagaggaagatcctgatgact
ctgacggtcaaggtcctcggggctcgccatctccccaaaactggccgaagtattgtgtgt
ccctttgtggaggtggaaatatgcggagccgagtatgacaacaacaaattcaaaacaaca
gttgtgaatgacaatggcctaagccctgtttgggctccaacgcaggagaaggtgacattt
gaaatttatgaccccaacctcgcatttctgcgcttcgtggtttatgaggaagatattttc
agcgatcccaactttctcgctcacgccacttaccccattaaaggcatcaaatcaggatac
cgatctgttcctctgaagaatgggtacagtgaagacatcgagctggcgtccctcctggtt
ttctgtgagatgcggccagtcctggtgagtggaggcacaccagcgggggttccctga

DBGET integrated database retrieval system