KEGG   Sus scrofa (pig): 100518663Help
Entry
100518663         CDS       T01009                                 

Gene name
PLCG2
Definition
phospholipase C, gamma 2 (phosphatidylinositol-specific)
Orthology
K05859  
phosphatidylinositol phospholipase C, gamma-2 [EC:3.1.4.11]
Organism
ssc  Sus scrofa (pig)
Pathway
Inositol phosphate metabolism
Metabolic pathways
ErbB signaling pathway
Ras signaling pathway
Calcium signaling pathway
NF-kappa B signaling pathway
HIF-1 signaling pathway
Phosphatidylinositol signaling system
VEGF signaling pathway
Osteoclast differentiation
Platelet activation
Natural killer cell mediated cytotoxicity
B cell receptor signaling pathway
Fc epsilon RI signaling pathway
Fc gamma R-mediated phagocytosis
Leukocyte transendothelial migration
Neurotrophin signaling pathway
Inflammatory mediator regulation of TRP channels
Thyroid hormone signaling pathway
Epstein-Barr virus infection
Pathways in cancer
Proteoglycans in cancer
MicroRNAs in cancer
Glioma
Non-small cell lung cancer
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100518663 (PLCG2)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100518663 (PLCG2)
   04012 ErbB signaling pathway
    100518663 (PLCG2)
   04370 VEGF signaling pathway
    100518663 (PLCG2)
   04064 NF-kappa B signaling pathway
    100518663 (PLCG2)
   04066 HIF-1 signaling pathway
    100518663 (PLCG2)
   04020 Calcium signaling pathway
    100518663 (PLCG2)
   04070 Phosphatidylinositol signaling system
    100518663 (PLCG2)
 Organismal Systems
  Immune system
   04611 Platelet activation
    100518663 (PLCG2)
   04650 Natural killer cell mediated cytotoxicity
    100518663 (PLCG2)
   04662 B cell receptor signaling pathway
    100518663 (PLCG2)
   04664 Fc epsilon RI signaling pathway
    100518663 (PLCG2)
   04666 Fc gamma R-mediated phagocytosis
    100518663 (PLCG2)
   04670 Leukocyte transendothelial migration
    100518663 (PLCG2)
  Endocrine system
   04919 Thyroid hormone signaling pathway
    100518663 (PLCG2)
  Nervous system
   04722 Neurotrophin signaling pathway
    100518663 (PLCG2)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100518663 (PLCG2)
  Development
   04380 Osteoclast differentiation
    100518663 (PLCG2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100518663 (PLCG2)
   05206 MicroRNAs in cancer
    100518663 (PLCG2)
   05205 Proteoglycans in cancer
    100518663 (PLCG2)
   05214 Glioma
    100518663 (PLCG2)
   05223 Non-small cell lung cancer
    100518663 (PLCG2)
  Infectious diseases
   05169 Epstein-Barr virus infection
    100518663 (PLCG2)
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100518663 (PLCG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
6
AA seq 1078 aa AA seqDB search
MVVVLMVLVVLMCQPPLLLSPNPALAMLFVDAIGLVCSISLRELKAILPLVNFKASSAKF
LKDKFLEIGAHKDELSFEQFHLFYKKLMFEQQKSILDEFKKDSSVFILGNTDRPDASAVH
LHDFQRFLLHEQQELWAQDLNKVRERMTKFIDDTMRETAEPFLFVDEFLTYLFSRENSIW
DEKYDVVDMQDMNNPLSHYWISSSHNTYLTGDQLRSESSTEAYIRCLRMGCRCIELDCWD
GPDGKPIIYHGWTRTTKIKFDDVVQAIKDHAFVTSSFPVILSIEEHCCVEQQRHMARVFK
EVFGDLLLTKPTEASADQLPSPSQLREKIIIKHKKLGPRGDVDVNMEDKKDEHKQQGELY
MWDSIDQKWTRHYCAIADAKLSFSDDIEQTVEEEPPVNTPPTELHFGEKWFHKKVEKRTS
AEKLLQEYCAETGGKDGTFLVRESETYPNDYTLSFWRSGRVQHCRIRSTMEGGVMKYYLT
DNLMFTSIYALIQHYRETHLRCAEFELRLTDPVPNPNPHESKPWYYDGLSRGEAEDMLMR
VPRDGAFLIRRREGTDSYAITFRARGKVKHCRINRDGRHFVLGTSAYFESLVELVSYYEK
HALYRKMRLRYPVTPELLERYNMERDINSLYDVSRMYVDPSEINPSMPQRTVKALYDYRA
KQSDELSFCRGALIHNVSKEPGGWWKGDYGTRIQQYFPSNYVEDISAVDVEELEKQIIED
NPLGSLCRGILDLNTYNVVKAPQGKNQKPFVFILEPKKQGDPPVEFATDRVEELFEWFQS
IREITWKIDTKENNMRYWEKNQSIAIELSDLVVYCKPTSKTKDNLENPDFREIRSFVETK
ADSVTRQKPNDLLKYNQKALTRIYPKGQRVDSSNYDPFRLWLCGSQMVALNFQTADKYMQ
MNHALFSLNGRTGYVLQPESMRAEKYDPMPPESQRKILMTLTVKVLGARHLPKTGRSIVC
PFVEVEICGAEYDNNKFKTTVVNDNGLSPVWAPTQEKVTFEIYDPNLAFLRFVVYEEDIF
SDPNFLAHATYPIKGIKSGYRSVPLKNGYSEDIELASLLVFCEMRPVLVSGGTPAGVP
NT seq 3237 nt NT seq  +upstreamnt  +downstreamnt
atggtggtggtgctgatggtgctggtggtgctgatgtgccagccccctctgctcctctcc
cccaaccctgccctggccatgctctttgtggatgccatagggctggtttgcagcatcagc
ctccgagagctgaaggccatcctgccgctggtcaacttcaaagcgagcagcgccaagttc
ctcaaagacaagtttctggaaattggcgcacacaaagatgaactcagctttgagcagttc
catctcttctataaaaaacttatgtttgaacagcaaaaatcgattctcgacgaattcaaa
aaggactcctccgtattcatcttgggcaacactgaccggccggacgcctctgctgtccac
ctgcacgacttccagcggtttctcttacatgagcagcaggaactttgggctcaggatctg
aacaaagtccgtgagcggatgaccaagtttatcgacgacaccatgagggaaactgccgag
cctttcttgtttgtggatgagttcctcacgtacctgttttcccgggagaacagcatttgg
gacgagaagtacgacgtggtggacatgcaggacatgaacaaccccttgtctcattactgg
atctcctcgtcccacaacacgtacctcacaggtgaccagctgcggagcgagtcgtccaca
gaggcgtacatccgctgtctgcggatgggctgccgctgcatcgagctggactgctgggac
gggcccgacgggaagcccatcatctaccacggctggacgcggaccaccaagatcaagttt
gacgatgtggtgcaggccatcaaagaccatgccttcgtcacctccagcttccccgtgatc
ctgtccatcgaggagcactgctgcgtggagcagcagcgccacatggccagggtgttcaag
gaggtgtttggggacctgctgctgacgaagcccacggaggccagtgccgaccagctgccc
tcgcccagccagctgcgggagaagatcatcatcaagcataagaagctgggcccccgaggc
gacgtggatgtcaacatggaggacaagaaagatgagcacaagcagcagggcgagctgtac
atgtgggattccatcgaccagaaatggacccggcactactgcgccattgctgatgccaag
ctgtccttcagcgatgacattgaacagactgtggaggaggaaccgcccgtgaacacgccc
cccacggagctgcattttggggagaagtggttccacaagaaggtggagaagaggacaagt
gccgagaagctgctgcaggagtactgtgccgagacagggggcaaggatgggaccttcttg
gtgcgggagagcgagacctaccccaacgactacaccctgtccttctggcggtcaggccga
gtgcagcactgccgcatccgctccaccatggagggcggggtcatgaagtactacctgact
gacaacctcatgttcaccagcatctacgccctcatccagcactaccgcgagacgcacctg
cgctgtgccgagttcgagctccggctgaccgaccccgtgcccaaccccaacccgcacgag
tcgaagccgtggtactatgacgggctgagccgcggagaagcggaggacatgctgatgagg
gttccccgggatggggccttcctcatccggaggcgggaaggtaccgactcctacgccatc
accttcagggccaggggcaaggtgaagcactgccgaatcaaccgggatggccggcacttc
gtgctgggcacctccgcctactttgagagcctcgtggagctggtcagctactacgagaag
cacgcgctctaccggaagatgagactgcgctaccctgtgacccccgagctcctggagcgc
tacaatatggaaagagatatcaactccctctatgacgtcagcagaatgtatgtggatccc
agtgaaatcaacccttccatgcctcagagaaccgtgaaagcgctgtatgactacagagcc
aagcaaagcgatgagctgagcttctgccgtggcgccctcatccataatgtctccaaggag
ccggggggctggtggaaaggagactacggaaccagaatccagcagtacttcccgtccaat
tacgtcgaggacatttcagccgttgatgtggaggagctggagaagcagattattgaagac
aatcccttagggtctctttgcagaggaatcctggatctcaacacctataatgtggtgaaa
gccccccaggggaaaaaccagaagcctttcgtctttatcttggagcccaagaagcagggc
gacccgccggtggagtttgccacggacagggtggaggagctctttgagtggtttcagagc
atccgggagatcacctggaagatagacaccaaggagaacaacatgaggtactgggagaag
aaccagtccatcgccatcgagctctcggacctggtcgtctactgcaaacccaccagcaag
accaaggacaacttagaaaaccccgacttccgagaaatccgctcctttgtggaaacgaag
gctgacagcgtcaccagacagaaacccaatgacctcctcaaatacaatcaaaaggctctg
acccgcatctaccccaagggacagcgggttgactcctccaactacgaccccttccgcctc
tggctgtgtggctcccagatggtggcactcaatttccagaccgcagataagtacatgcag
atgaaccacgctctgttttccctcaacggacggacgggttacgtcctgcagcccgagagc
atgagggccgagaagtacgaccccatgccgcccgagtcgcagaggaagatcctgatgact
ctgacggtcaaggtcctcggggctcgccatctccccaaaactggccgaagtattgtgtgt
ccctttgtggaggtggaaatatgcggagccgagtatgacaacaacaaattcaaaacaaca
gttgtgaatgacaatggcctaagccctgtttgggctccaacgcaggagaaggtgacattt
gaaatttatgaccccaacctcgcatttctgcgcttcgtggtttatgaggaagatattttc
agcgatcccaactttctcgctcacgccacttaccccattaaaggcatcaaatcaggatac
cgatctgttcctctgaagaatgggtacagtgaagacatcgagctggcgtccctcctggtt
ttctgtgagatgcggccagtcctggtgagtggaggcacaccagcgggggttccctga

DBGET integrated database retrieval system