KEGG   Sus scrofa (pig): 100518871Help
Entry
100518871         CDS       T01009                                 

Gene name
G6PC2
Definition
glucose-6-phosphatase, catalytic, 2
Orthology
K01084  
glucose-6-phosphatase [EC:3.1.3.9]
Organism
ssc  Sus scrofa (pig)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
FoxO signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100518871 (G6PC2)
   00052 Galactose metabolism
    100518871 (G6PC2)
   00500 Starch and sucrose metabolism
    100518871 (G6PC2)
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    100518871 (G6PC2)
   04151 PI3K-Akt signaling pathway
    100518871 (G6PC2)
   04152 AMPK signaling pathway
    100518871 (G6PC2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100518871 (G6PC2)
   04920 Adipocytokine signaling pathway
    100518871 (G6PC2)
  Digestive system
   04973 Carbohydrate digestion and absorption
    100518871 (G6PC2)
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.9  glucose-6-phosphatase
     100518871 (G6PC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
15
AA seq 154 aa AA seqDB search
MDFLHRNGVLLIQHLQKDYRAYYSFLNFMSNVGDPRNIFSIYFPLWFQLNQRVGTKMIWV
AVIGDWFNLIFKWILFGHRPYWWVQETQIYPNHSSPCLEQFPTTCETGPGSPSGHAMGSS
CVWYVMVTAALGHTIRWMDKSSTTLHRHACGRGL
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggatttccttcataggaatggcgtgctccttattcagcatttgcaaaaggactaccga
gcttactacagttttctaaattttatgtccaatgttggagatccccggaatattttttct
atttattttccactttggtttcaacttaatcagagagttggaaccaagatgatatgggta
gcagtcattggggattggttcaatctgatttttaaatggatattatttggtcatcggcct
tactggtgggtccaagaaactcagatttacccaaatcactcaagtccatgccttgaacag
ttccccactacatgtgaaacaggtccaggaagtccatctggccatgcaatgggctcatca
tgtgtctggtatgtcatggtgacggctgccctgggtcacaccatcaggtggatggataag
tcttctaccactctgcacaggcatgcttgtggcagaggtctttga

DBGET integrated database retrieval system