KEGG   Sus scrofa (pig): 100518871Help
Entry
100518871         CDS       T01009                                 

Gene name
G6PC2
Definition
(RefSeq) glucose-6-phosphatase 2
  KO
K01084  glucose-6-phosphatase [EC:3.1.3.9]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00010  Glycolysis / Gluconeogenesis
ssc00052  Galactose metabolism
ssc00500  Starch and sucrose metabolism
ssc01100  Metabolic pathways
ssc04068  FoxO signaling pathway
ssc04151  PI3K-Akt signaling pathway
ssc04152  AMPK signaling pathway
ssc04910  Insulin signaling pathway
ssc04920  Adipocytokine signaling pathway
ssc04922  Glucagon signaling pathway
ssc04931  Insulin resistance
ssc04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100518871 (G6PC2)
   00052 Galactose metabolism
    100518871 (G6PC2)
   00500 Starch and sucrose metabolism
    100518871 (G6PC2)
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    100518871 (G6PC2)
   04151 PI3K-Akt signaling pathway
    100518871 (G6PC2)
   04152 AMPK signaling pathway
    100518871 (G6PC2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100518871 (G6PC2)
   04922 Glucagon signaling pathway
    100518871 (G6PC2)
   04920 Adipocytokine signaling pathway
    100518871 (G6PC2)
  Digestive system
   04973 Carbohydrate digestion and absorption
    100518871 (G6PC2)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    100518871 (G6PC2)
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.9  glucose-6-phosphatase
     100518871 (G6PC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PAP2
Motif
Other DBs
NCBI-GeneID: 100518871
NCBI-ProteinID: XP_003133509
Position
15
AA seq 154 aa AA seqDB search
MDFLHRNGVLLIQHLQKDYRAYYSFLNFMSNVGDPRNIFSIYFPLWFQLNQRVGTKMIWV
AVIGDWFNLIFKWILFGHRPYWWVQETQIYPNHSSPCLEQFPTTCETGPGSPSGHAMGSS
CVWYVMVTAALGHTIRWMDKSSTTLHRHACGRGL
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggatttccttcataggaatggcgtgctccttattcagcatttgcaaaaggactaccga
gcttactacagttttctaaattttatgtccaatgttggagatccccggaatattttttct
atttattttccactttggtttcaacttaatcagagagttggaaccaagatgatatgggta
gcagtcattggggattggttcaatctgatttttaaatggatattatttggtcatcggcct
tactggtgggtccaagaaactcagatttacccaaatcactcaagtccatgccttgaacag
ttccccactacatgtgaaacaggtccaggaagtccatctggccatgcaatgggctcatca
tgtgtctggtatgtcatggtgacggctgccctgggtcacaccatcaggtggatggataag
tcttctaccactctgcacaggcatgcttgtggcagaggtctttga

DBGET integrated database retrieval system