KEGG   Sus scrofa (pig): 100518997Help
Entry
100518997         CDS       T01009                                 

Gene name
FLNC
Definition
filamin C, gamma
Orthology
K04437  
filamin
Organism
ssc  Sus scrofa (pig)
Pathway
MAPK signaling pathway
Focal adhesion
Salmonella infection
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100518997 (FLNC)
 Cellular Processes
  Cell communication
   04510 Focal adhesion
    100518997 (FLNC)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    100518997 (FLNC)
  Infectious diseases
   05132 Salmonella infection
    100518997 (FLNC)
Exosome [BR:ssc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100518997 (FLNC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
18
AA seq 2720 aa AA seqDB search
MMNNSGYSEAAGLGLGDEVDDMPSTEKDLAEDAPWKKIQQNTFTRWCNEHLKCVGKRLTD
LQRDLSDGLRLIALLEVLSQKRMYRKFHPRPNFRQMKLENVSVALEFLEREHIKLVSIDS
KAIVDGNLKLILGLIWTLILHYSISMPMWEDEDDEDARKQTPKQRLLGWIQNKVPQLPIT
NFNRDWQDGKALGALVDNCAPGLCPDWEAWDPNQPVENAREAMQQADDWLGVPQVIAPEE
IVDPNVDEHSVMTYLSQFPKAKLKPGAPVRSKQLNPKKAIAYGPGIEPQGNTVLQPAHFT
VQTVDAGVGEVLVYIEDPEGHTEEAKVVPNNDKDRTYAVSYVPKVAGLHKVTVLFAGQNI
ERSPFEVNVGMALGDANKVSARGPGLEPVGNVANKPTYFDIYTAGAGTGDVAVVIVDPQG
RRDTVEVALEDKGDSTFRCTYRPVMEGPHTVHVAFAGAPITRSPFPVHVAEACNPNACRA
SGRGLQPKGVRVKEVADFKVFTKGAGSGELKVTVKGPKGTEEPVKVRDAGDGVFECEYYP
VVPGKYVVTITWGGYAIPRSPFEVQVSPEAGMQKVRAWGPGLETGQVGKSADFVVEAIGT
EVGTLGFSIEGPSQAKIECDDKGDGSCDVRYWPTEPGEYAVHVICDDEDIRDSPFIAHIQ
PAPPDCFPDKVKAFGPGLEPTGCIVDKPAEFTIDARAAGKGDLKLYAQDADGCPIDIKVI
PNGDGTFRCSYVPTKPIKHTIIISWGGVNVPKSPFRVNVGEGSHPERVKVYGPGVEKTGL
KANEPTYFTVDCSEAGQGDVSIGIKCAPGVVGPAEADIDFDIIKNDNDTFTVKYTPPGAG
RYTIMVLFANQEIPASPFHIKVDPSHDASKVKAEGPGLNRTGVEVGKPTHFTVLTKGAGK
AKLDVHFAGAAKGEAVRDFEIIDNHDYSYTVKYTAVQQGNMAVTVTYGGDPVPKSPFVVN
VAPPLDLSKVKVQGLNSKVAVGQEQAFSVNTRGAGGQGQLDVRMTSPSRRPIPCKLEPGG
GADAQAVRYMPPEEGPYKVDITYDGHPVPGSPFAVEGVLPPDPSKVCAYGPGLKGGLVGT
PAPFSIDTKGAGTGGLGLTVEGPCEAKIECQDNGDGSCAVSYLPTEPGEYTINILFAEAH
IPGSPFKATIRPVFDPSKVRASGPGLERGKAGEAATFTVDCSEAGEAELTIEILSDAGVK
AEVLIHNNADGTYHITYSPAFPGTYTITIKYGGHPVPKFPTRVHVQPAVDTSGVKVSGPG
VEPHGVLREVTTEFTVDARSLTATGGNHVTARVLNPSGAKTDTYVTDNGDGTYRVQYTAY
EEGVHLVEVLYDDVAVPKSPFRVGVTEGCDPTRVRAFGPGLEGGLVNKANRFTVETRGAG
TGGLGLAIEGPSEAKMSCKDNKDGSCTVEYIPFTPGDYDVNITFGGRPIPGSPFRVPVKD
VVDPGKVKCSGPGLGAGVRARVPQTFTVDCSQAGRAPLQVAVLSPTGVAEPVEVRDNGDG
THTVHYTPATDGPYTVAVKYADQEVPRSPFKIKVLPAHDASKVRASGPGLNASGIPASLP
VEFTIDARDAGEGLLTVQILDPEGKPKKANIRDNGDGTYTVSYLPDMSGRYTITIKYGGD
EIPYSPFRIHALPTGDASKCLVTVSIGGHGLGACLGPRIQIGEETVITVDAKAAGKGKVT
CTVSTPDGAELDVDVVENHDGTFDIYYTAPEPGKYVITIRFGGEHIPNSPFHVLACDPMP
HVEEPSEVLQLHRPSAYPTHWATEEPVVPVESMESMLRPFNLVIPFTVQKGELTGEVRMP
SGKTARPNITDNKDGTITVRYAPTEKGLHQMGIKYDGNHIPGSPLQFYVDAINSRHVSAY
GPGLSHGMVNKPATFTIVTKDAGEGGLSLAVEGPSKAEITCKDNKDGTCTVSYLPTAPGD
YSIIVRFDDKHIPGSPFTAKITGDDSMRTSQLNVGTSTDVSLKITESDLSQLTASIRAPS
GNEEPCLLKRLPNRHIGISFTPKEVGEHVVSVRKSGKHVTNSPFKILVGPSEIGDASKVR
VWGKGLSEGQTFQVAEFIVDTRNAGYGGLGLSIEGPSKVDINCEDMEDGTCKVTYCPTEP
GTYIINIKFADKHVPGSPFTVKVTGEGRMKESITRRRQAPSIATIGSTCDLNLKIPGNWF
QMVSAQERLTRTFTRSSHTYTRTERTEISKTRGGETKREVRVEESTQVGGDPFPAVFGDF
LGRERLGSFGSITRQQEGEASSQDMTAQVTSPSGKTEAAEIVEGEDSAYSVRFVPQEMGP
HTVTVKYRGQHVPGSPFQFTVGPLGEGGAHKVRAGGTGLERGVAGVPAEFSIWTREAGAG
GLSIAVEGPSKAEIAFEDRKDGSCGVSYVVQEPGDYEVSIKFNDEHIPDSPFVVPVASLS
DDARRLTVTSLQETGLKVNQPASFAVQLNGARGVIDARVHTPSGAVEECYVSELDSDKHT
IRFIPHENGVHSIDVKFNGAHIPGSPFKIRVGEQSQAGDPGLVSAYGPGLEGGTTGVSSE
FIVNTLNAGSGALSVTIDGPSKVQLDCRECPEGHVVTYTPMAPGNYLIAIKYGGPQHIVG
SPFKAKVTGPRLSGGHSLHETSTVLVETVTKSSSSRGSSYSSIPKFSSDASKVVTRGPGL
SQAFVGQKNSFTVDCSKAGTNMMMVGVHGPKTPCEEVYVKHVGNRVYNVTYTVKEKGDYI
LIVKWGDESVPGSPFKVNVP
NT seq 8163 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacaacagcggttactccgaggccgcgggcctcggcctgggcgacgaggtggac
gacatgccctctacagagaaggacctggccgaggacgcgccgtggaagaagatccagcag
aacacgttcactcgctggtgcaatgagcacctcaagtgcgtgggcaagcgcctgaccgac
ctgcagcgagacctcagcgacgggctgcgcctcatcgcgctgctcgaggtgctcagccag
aagcgcatgtaccgcaagtttcacccgcgccccaacttccgccagatgaagctggagaac
gtgtccgtggccctcgagttcctcgagcgcgagcatatcaagctcgtgtccatcgacagc
aaggccatcgtggatgggaacctgaagctgatcctgggcctgatctggaccctgatcctg
cactactccatctccatgcccatgtgggaggatgaggacgacgaggatgctcgcaagcag
acgcccaagcagaggctgctcggctggatccagaacaaggtgccccagctgcccatcacc
aacttcaaccgtgactggcaggacggcaaagctctgggcgccctggtggacaactgcgcc
cctggcctctgccccgactgggaggcctgggaccccaaccagcctgtggagaacgcccgg
gaggccatgcagcaggcagacgactggctcggggtgccccaggtgatcgcgcccgaggag
attgtggaccccaatgtggatgagcactctgtcatgacctacctgtcccagttccccaag
gccaaactcaaacccggtgcccctgttcgctccaagcagctgaaccccaagaaggccatc
gcctacgggcctggcatcgagccccagggcaacaccgtgctacagccggcgcacttcacc
gtgcagaccgtggatgccggcgtgggcgaggtgctggtctacatcgaggatcccgagggc
cacaccgaggaggccaaggtggttcccaacaacgacaaggaccgcacctacgctgtctcc
tacgtgcccaaggtcgcgggcttgcacaaggtgaccgtgctctttgctggccagaacatc
gaacgcagcccctttgaggtgaacgtgggcatggcgctgggggatgccaacaaggtgtca
gcccgtggtcctggcctagagcctgtgggcaacgtggccaacaaacccacctactttgac
atctacactgcgggggccggcactggtgatgttgccgtggtgatcgtggacccgcagggc
cggcgggacacagtggaggtggccctggaggacaagggcgacagcacgttccgttgcaca
tacaggcctgtgatggaggggccccacacagtgcatgtggccttcgctggcgcccccatc
acccgcagccctttccccgtccacgtggcagaagcctgtaaccccaatgcctgccgcgcc
tctgggcggggcttgcagcccaagggcgtgcgcgtcaaagaggtggctgacttcaaggtg
ttcaccaagggtgctggcagcggagagctcaaggtcaccgtcaagggaccgaagggcaca
gaggagccggtgaaggtgcgcgacgctggggatggtgtgttcgagtgtgagtactacccc
gtggtgcctggcaagtacgtggtgaccatcacgtggggcggctatgccatcccccgcagc
ccctttgaggtacaggtgagccccgaggcaggaatgcagaaggtgcgggcctggggtccc
ggtttggaaaccgggcaggtgggcaagtcggccgacttcgtggtggaggccattggcacg
gaggtggggaccctgggcttctccattgaggggccttcccaggccaagatcgagtgtgac
gacaagggcgatggctcctgtgatgtgcggtactggcccacagagcccggagagtacgcc
gtgcacgtcatctgcgatgacgaggacatccgcgactcgcccttcattgcccacatccag
ccagcgccacccgactgcttcccggacaaggtgaaggcctttgggcccggcctggagccc
actggctgcatcgtggacaagcctgccgagttcaccattgatgcccgtgcagctggcaag
ggagacctgaagctttatgcccaggacgctgacggctgccccatcgacatcaaggtcatc
cccaacggcgacggcaccttccgctgctcctacgtgcccaccaagcccattaagcacacc
atcatcatctcctggggaggcgtcaatgtgcctaagagccccttccgggtgaacgtggga
gagggcagtcatcccgagcgggtgaaggtgtacggtccaggcgtggagaagacgggcctc
aaggctaatgaacccacctacttcacggtggactgcagcgaggcggggcaaggcgacgtg
agcattggtatcaagtgcgcccctggcgtagtgggccccgcagaggctgatatcgacttt
gacatcatcaagaatgacaatgacaccttcacagtcaagtacacacccccaggggctggc
cgctacaccatcatggtgctgtttgccaaccaggagatcccggccagccccttccatatc
aaggtggacccatcccatgatgccagcaaggtcaaggctgagggtcctgggctgaaccgc
acaggtgtggaggttggaaagcccactcacttcacggtgctgaccaagggagccggcaag
gccaagctggacgtgcactttgctggggccgccaagggcgaagctgtgcgagactttgag
atcatcgacaaccatgactactcctacaccgtcaagtacacggccgtgcagcagggcaac
atggcagtgacagtgacctatggtggagaccctgtccccaagagcccctttgtggtgaat
gtggcccccccgctggacctcagcaaagtcaaagttcaagggctcaacagcaaggtggcc
gtggggcaagaacaggcgttctccgtgaacacacgaggggctggtggtcagggccagctg
gacgtgcggatgacctctccctcccgacgacccatcccctgcaagctggaacccgggggt
ggcgctgacgcgcaggctgtgcgctacatgccccccgaggaggggccctacaaggtggac
atcacctacgacggccacccggtacctggcagtccctttgccgtggagggtgtcctgcct
cccgacccctccaaggtttgcgcttacggccctggccttaagggcgggctggtaggcacg
ccagcgcccttctccatcgacaccaagggggcgggcacaggaggcctggggctgactgtg
gagggcccctgcgaggccaagatcgagtgccaggacaacggtgatggctcgtgtgctgtc
agctacctgcccacggagccgggcgagtacaccatcaacatcctgttcgccgaagcccat
atccccggctctcccttcaaggctaccatccggcctgtgttcgacccgagcaaggtgcgg
gccagcgggccgggcctggagcgaggcaaggctggcgaggcagccaccttcactgtggac
tgctcagaggcgggcgaggctgagctgaccatcgagatcctgtcggacgccggggtcaag
gccgaggtgctgatccacaacaatgccgacggcacctaccacatcacctacagccccgcc
ttccctggcacctacaccatcaccatcaagtacggcgggcaccccgtacccaagtttccc
acccgtgtccatgtgcagcctgctgtcgacaccagcggcgtcaaggtctcggggcccggg
gtggagccgcatggtgtcctgcgtgaggtgaccaccgagttcactgtggacgcaagatcc
ctaacagccacgggtggcaaccacgtgacggcgcgcgtgctcaacccctcaggcgctaag
acagacacctacgtgactgacaacggggacggcacctaccgggtgcagtacacagcctac
gaagagggcgtgcatttggtggaggtgctctacgatgacgtagctgtgcccaagagcccc
ttccgagtgggtgtgacggagggctgtgaccccacccgcgtccgggcctttgggccaggc
ctggagggtggcttggttaacaaggccaaccgcttcactgtggaaaccaggggagctgga
accgggggcctaggtctggccattgagggcccctcagaagccaagatgtcctgcaaggac
aacaaggacggaagctgcacggtggagtacatccccttcacccctggagactacgacgtc
aacatcaccttcgggggccggcccatcccaggaagccccttccgggtgccggtgaaggat
gtggtggaccctgggaaggtgaagtgctcgggcccagggctgggagctggtgtcagagcc
cgggtaccccagaccttcacagtggactgcagccaggccggccgggcccccctgcaggtg
gccgtgctcagccccacaggagtggctgagcctgtggaggtgcgtgacaatggagatggc
acccacactgtccactacaccccggccactgatgggccctacacggtagctgtcaagtat
gccgaccaggaggtgccacgcagccccttcaagatcaaggtacttccggcccatgatgcc
agcaaggtgcgggccagtggccccggcctcaatgcctccggcatccctgccagcctgcct
gtggagttcaccattgatgcccgggacgctggcgagggcttgctcactgtccagatcctg
gatcctgagggtaagcccaagaaggccaacatccgagacaacggggatggcacctacacc
gtgtcctacctgccagacatgagcggccggtacaccatcaccatcaagtacggcggcgat
gagatcccctactcgcccttccgcatccacgccctgcccacgggggacgccagcaagtgc
ctcgtcacagtgtctattggtggccacggcctgggtgcctgcctgggcccccgcatccag
attggggaagagacggtgatcacagtggacgccaaggcagccggcaaggggaaggtgacg
tgcacggtgtccacacccgacggggccgagcttgacgtggacgtggtcgagaaccacgac
gggacctttgacatttactacacggcgcccgagccgggcaaatacgtcatcaccatccgc
ttcggaggcgagcacatccccaacagccccttccacgtgctggcgtgtgaccccatgccc
cacgtggaagagccctctgaagtgctgcagctgcaccggcccagcgcctaccccacacac
tgggccacagaggagccagtggtacctgtggagtcgatggagtccatgctgagacccttc
aacctggtcattcccttcactgtgcagaaaggggagctcacaggggaggtacggatgccc
tctgggaagaccgcccggcctaacatcactgacaacaaagacggcacgatcacggtgagg
tacgcgcccaccgagaaaggcctgcaccagatggggatcaagtatgacggcaaccacatc
cctgggagccccctgcagttctacgtggatgccatcaacagccgccatgtcagtgcctac
gggccaggcctgagccatggcatggtcaacaagccagccaccttcaccatcgtcaccaag
gatgctggggaaggggggctgtccctggccgtggaaggcccatccaaggcggagatcacc
tgcaaggacaacaaggatggcacctgcactgtgtcctacctccccaccgcacctggtgac
tacagcatcattgtgcgctttgacgacaagcacatcccagggagccccttcacggccaag
atcacaggtgatgactcaatgaggacatcacagctgaatgtgggcacgtccacggatgtg
tcgctgaagatcactgagagtgacctgagccagctgaccgccagcatccgtgccccctcg
ggcaacgaggagccctgcctgctgaagcgcctgcccaaccggcacattggtatctccttc
acccccaaggaggttggggagcacgtggtgagcgtgcgcaagagcggcaagcacgtcacc
aacagccccttcaagatcctggtggggccgtctgagattggggacgctagcaaggtccgg
gtctggggcaagggtctgtccgagggacagacgttccaggtggcggagttcatcgtggac
actcggaacgcaggctacgggggcctggggctgagcattgaaggcccaagcaaggtggac
atcaactgtgaggatatggaggatggcacctgcaaagtcacctactgccccaccgaaccc
ggcacctacatcatcaacatcaagtttgccgacaagcacgtacctggaagccccttcacg
gtgaaggtgacgggcgagggccgcatgaaggagagcatcacgcggcgcaggcaggcgcct
tccatcgccaccatcggcagcacctgcgacctcaacctcaagatcccagggaactggttc
cagatggtgtctgcccaggagcgcctgacacgtaccttcacccgcagcagccacacgtac
acccgtacggagcgcacggagatcagcaagacgcggggtggggagaccaagcgcgaggtg
cgggtggaggagtccactcaggttggcggagaccccttccccgccgtcttcggggacttc
ctgggccgggaacgtctgggctctttcggcagcatcactcggcagcaagagggtgaggcc
agctctcaggacatgaccgcacaggtgaccagcccctcaggcaagacggaggccgcggag
atcgtggagggggaggacagcgcgtacagcgtgcgcttcgtgccccaggagatggggccc
cacacggtcaccgtcaagtaccgcggccagcacgtgccaggcagcccctttcagttcacc
gtggggccactgggtgaaggtggtgcccacaaggtgcgggctggaggcacagggctagag
cgaggggtggccggtgtgccagccgagttcagcatctggacccgagaagctggtgccggg
ggcctgtctattgctgtggagggccccagcaaggcagagattgcatttgaggaccgcaaa
gatggctcctgcggggtctcctatgtcgtccaggaaccaggtgactatgaggtctccatc
aagttcaatgatgagcacatcccggacagcccctttgtggtgcccgtggcctccctctcg
gatgatgctcgccgtcttactgtcaccagcctccaggagacagggctcaaggtgaaccag
ccggcgtcctttgcggtgcagctgaacggtgctcggggtgtgatcgatgcccgggtgcac
acgccctcgggtgccgtggaggagtgctacgtgtccgagctggacagtgacaagcacacc
atccgcttcatccctcatgagaacggcgtccactccatcgatgtcaagttcaacggtgcc
cacatccccggcagtcccttcaagatccgcgtcggggagcagagccaggctggggaccca
ggcttggtgtcagcgtatggtcctgggctcgagggaggcactacaggagtgtcatccgag
ttcatcgtcaacaccttgaatgcgggctcaggggccttatctgtcaccatcgacggcccc
tccaaggtgcagctagactgtcgggagtgtcctgaggggcacgtggttacctatactccc
atggctcctggcaactacctcattgccatcaagtatggtggcccccagcacattgtgggc
agccccttcaaggccaaagtcacaggtccccggctgtcaggaggccacagccttcacgag
acctccacggttctggtggagactgtgaccaagtcgtcctcaagccggggctccagctac
agctccatccccaagttctcctcggatgccagcaaggtggtgacgcggggccccgggctg
tcccaggcctttgtgggccagaagaactccttcaccgtggactgcagcaaagcaggcacc
aacatgatgatggtgggcgtgcacgggcccaagaccccctgtgaggaggtgtacgtgaag
cacgtggggaaccgggtctacaacgtcacctacaccgtcaaggagaaaggggactacatc
ctcattgtcaagtggggcgacgaaagtgtccccggaagccccttcaaagtcaacgtgccc
tga

DBGET integrated database retrieval system