KEGG   Sus scrofa (pig): 100519210Help
Entry
100519210         CDS       T01009                                 

Gene name
SPHK1
Definition
(RefSeq) sphingosine kinase 1 isoform X1
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00600  Sphingolipid metabolism
ssc01100  Metabolic pathways
ssc04020  Calcium signaling pathway
ssc04071  Sphingolipid signaling pathway
ssc04072  Phospholipase D signaling pathway
ssc04370  VEGF signaling pathway
ssc04371  Apelin signaling pathway
ssc04666  Fc gamma R-mediated phagocytosis
ssc05152  Tuberculosis
Module
ssc_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    100519210 (SPHK1)
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    100519210 (SPHK1)
   04371 Apelin signaling pathway
    100519210 (SPHK1)
   04020 Calcium signaling pathway
    100519210 (SPHK1)
   04072 Phospholipase D signaling pathway
    100519210 (SPHK1)
   04071 Sphingolipid signaling pathway
    100519210 (SPHK1)
 Organismal Systems
  Immune system
   04666 Fc gamma R-mediated phagocytosis
    100519210 (SPHK1)
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    100519210 (SPHK1)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     100519210 (SPHK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_cat
Motif
Other DBs
NCBI-GeneID: 100519210
NCBI-ProteinID: XP_005656972
Ensembl: ENSSSCG00000017178
UniProt: A0A287AP24
Position
12
AA seq 495 aa AA seqDB search
MPERAAPRARSKDLAGRPLPQGAAPDATKAVSSPSDPATAGNDAGASTAPAPGGEGEPHS
RHRDARLGSTDKELKAGTEAADSARTAPGTPWQRGPRVKVMDAAGGPRILLPRPCRVLVL
LNPRGGKGKGLQLFRSHVQPLLVQADISFTLMLTDRRNHARELVRAEDLRLWDALVIMSG
DGLMHEVVNGLMERPDWETAMQKPLCSLPAGSGNALAASLNHYAGYEQVTNEDLLTNCTR
LLCRRVLSPMDLLSLQTASGLRVFSVLSLTWGFIADVDLESEKFRGLGEMRFTLGTFLRL
VTLRTYRGRLAYLPVETVVSKMPPASAPAQWAQQGPVDTHLVPLEEPVPSHWTVVPEQDF
VLVLALLHSHLGSEMFAAPMGRCTAGAMHLFYVRAGVSRAMLLRLFLAMEKGRHMECECP
HLVYVPVVAFRLEPKDGKGVFAVDGEMLVSEAVQGQVHPNYFWMVSGCSESLPSREPQPS
LSQKPQQRPPREERS
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgccggagcgcgcggctccccgcgcgcggtccaaggatctagcggggcgccccctacct
cagggggccgctccggacgccaccaaggctgtctcctctccctcagatccagcaaccgca
gggaatgacgcgggtgcctccacagccccggctccgggcggggagggcgagccccacagt
cggcaccgcgacgcccgcctgggcagcaccgataaggagctgaaggcaggaaccgaggcc
gcggacagcgcccggacagcgccggggaccccctggcagcgggggccacgggtcaaggtt
atggatgcagcgggcggcccccggatcctgctcccacggccctgccgcgtgctggtgctg
ttaaatccgcgcgggggcaaaggcaagggcctgcagctcttccggagccacgtgcagccc
ctgctggtccaggccgacatttccttcacgctgatgctcaccgaccggcggaaccacgcc
cgggagctggtgagggcggaggacctgagactctgggacgcgctggtgattatgtctgga
gacgggctgatgcatgaggtggtgaacgggctcatggagcggccggactgggagaccgcc
atgcagaagcccctgtgtagcctcccagccggctctggcaatgcactggcagcttctttg
aaccactatgccggctacgagcaggtgacgaatgaagacctcctgaccaactgcacacgg
ctgctgtgtcgccgggtgctgtcgcccatggatctgctgtccctgcagacagcctcaggg
ctgcgcgtcttctccgtgctcagcctgacatggggtttcatcgcggacgtggatctggag
agtgagaagtttcggggcctgggcgagatgcggttcactctgggcaccttcctgcgcctg
gtgaccctgcgcacctaccggggtcgcctggcctacctccctgtagaaacggtggtctcc
aagatgccccccgcctccgctccggcccagtgggcccagcagggccctgtggacacccac
ctggtgcccctggaggagccggtgccctcccactggaccgtggtgccggagcaggacttt
gtgctggtgctggcgctgctgcactcacacctgggcagcgagatgttcgctgcacccatg
ggccgctgcacggccggcgccatgcacctgttctatgtgcgggctggcgtgtctcgggcc
atgctgctgcgcctcttcctggccatggagaaaggcaggcacatggagtgtgagtgtccc
cacttggtgtacgtaccggtggttgccttccgcctggagcccaaggacgggaagggtgtg
tttgctgtggacggagaaatgttggttagtgaggctgtgcagggccaggtgcacccaaac
tacttctggatggtcagtggctgctcagagtccctcccctcccgggagccgcagccctca
ctcagccagaagcctcagcagaggccaccccgggaagagcgctcatga

DBGET integrated database retrieval system