KEGG   Sus scrofa (pig): 100519306Help
Entry
100519306         CDS       T01009                                 

Gene name
PLB1
Definition
phospholipase B1
Orthology
K14621  
phospholipase B1, membrane-associated [EC:3.1.1.4 3.1.1.5]
Organism
ssc  Sus scrofa (pig)
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Vitamin digestion and absorption
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:ssc00564]
Metabolism; Lipid metabolism; Ether lipid metabolism [PATH:ssc00565]
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:ssc00590]
Metabolism; Lipid metabolism; Linoleic acid metabolism [PATH:ssc00591]
Metabolism; Lipid metabolism; alpha-Linolenic acid metabolism [PATH:ssc00592]
Organismal Systems; Digestive system; Vitamin digestion and absorption [PATH:ssc04977]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 902 aa AA seqDB search
MTQGMTPVLSCTHLFGLVCRNLCPCVLKFDDNSTELASLIEVNKKYQEGTHQLVESGRYD
TREDFTVVVQPFLEKVDMPKTPDGLPDSSFFAPDCFHFSSKAHAHAASALWNNMLEPVGQ
KTTQHKFESKINIMCPNQDWPYLSTYKNDVQDYGSRLLCSDRAPSASPPTSVHALRPADI
QVVAALGDSLTAGNGIGSKADDLSDVTTQYRGLSFSSGGDSYLEKVTTLPNILRKFNGNL
TGYAVGTGDANDTNASFNQAVPGAKTKELASQVQTLIQKMKDDHRVNFQGDWKIITVLIG
GSDLCDYCTDSNLYSAANFFVHLRNALDILHREVPRALVNLVDFMSPSVMRQTFLGNPDK
CPLQQASVFCNCVLTPRESSQELARLEAVTRAYQSSARELVESGRYDTREDFSVVLQPFF
SNLRLPVLEDGSLDLSFFAPDCLHPSQKFHSQLSRALWVNMLEPVGRKTDTLDLMADIPL
PCPTQNEPFLRTARNSNYTYPSNPAIENWGSDFLCTEWNPSTSVPTSVHELRPADIKVVA
ALGDSVTTAVGARPSNTSDLPTSWRGLSWSIGGDGDLESHTTLPNILKKFNPNILGFSTG
TQEETAGLNVAVEGARARDMPTQARDLVERMKNSAEINLHKDWKLITLFIGSNDLCHYCE
NPEAHSAQEYVWHIQQALDILYQELPRAFVNVVEVMELAGLYQGQGDTCVMPLAAQSNCA
CFRGSQENSLEMQELKTVNWNFQSSISGFSFRPQYLQREDFAVVVQPFFRHTLAPLNNRG
GADLSIFSEDCLHFSEHGHAELAIALWNNMMEPVGRKTTSNNFTYSRTKLKCPSPDSPYI
YTLRNSQLLQDKAAAGPKELPWATPVAAGCGLVVGIGTVMAWRALRRRQRGNPPISLNTG
SF
NT seq 2709 nt NT seq  +upstreamnt  +downstreamnt
atgacccaagggatgaccccggttctgtcatgcactcatctctttggtttggtctgcagg
aatctgtgtccctgtgtcctgaagtttgatgataactccacagaacttgcctccctcatc
gaggtgaataagaaatatcaggaggggactcaccagctggttgagagtgggcgttacgac
acgagggaagattttacagtggtcgtgcagccgttccttgagaaagtggacatgccaaag
accccggatgggttgcctgacagctctttctttgcccccgactgcttccacttcagcagc
aaggctcatgcccacgcagccagcgccctctggaacaacatgctggagcctgtcggccag
aagacaacacagcataagtttgaaagcaagatcaacatcatgtgtccaaaccaggactgg
ccatatctgagcacctacaagaacgacgtgcaggattatgggagccggttgctatgcagt
gacagagccccttctgcctcgccgcccacctcagtgcacgccctgagacctgcagacatc
caggttgtggctgctctgggggattctctgaccgctggcaatggaattggctccaaagca
gatgacctttctgatgtcaccactcagtaccgggggctgtcatttagttcaggaggggac
agctacctggagaaggtgaccaccttaccaaatatcctgcggaagtttaacggaaatctc
acaggctatgcggtgggcacaggtgacgccaatgacacaaatgcatccttcaatcaggct
gttcctggcgccaagactaaggaacttgcgagccaagtccagactctgatacagaagatg
aaagatgaccacagagtaaatttccaaggagactggaagatcatcacggtgctgattgga
ggctctgatttatgtgactactgcacagattcgaatctgtattctgcagccaactttttt
gtccatctccgcaacgccttggacatcctgcatagagaggtgcccagggcgctggtcaac
ctcgtggacttcatgagccccagtgtcatgcggcagacattcctggggaaccctgacaag
tgccctctgcagcaggccagtgttttctgtaactgtgttctgaccccgcgggagagctcc
caagagctggccaggttggaagccgtcacccgagcctaccagagcagtgcgcgcgagctg
gtggagtcaggccgctacgacacgcgggaggacttctctgtggtgctgcagcccttcttc
tccaacctccggctgcccgtcctggaggacgggagcctggacctgtccttctttgctccg
gactgcctccacccaagtcagaagttccactcccaactctccagagccctttgggtcaat
atgctggaaccagtaggaaggaaaacagacaccctggacttgatggcagacatacccctc
ccctgccccacccagaacgagcccttcctgagaactgcccggaacagtaactacacatac
cccagcaacccagccattgagaactggggcagcgacttcctgtgtacggagtggaatcct
tccaccagtgtccccacgtcagtccatgagctccggcctgcagacatcaaagtggtggcc
gccctgggagactctgtgactacagcggtgggagcccgacccagcaacaccagtgacctc
cccacatcctggaggggactctcctggagcatcggcggggatggtgatttggagagccac
accacactgcccaacattctgaagaagttcaaccccaacatcctgggcttctccactggc
acccaggaggagacggcagggctgaatgtagccgtggaaggggcccgagctcgggacatg
ccaacccaggcccgggaccttgtggagagaatgaaaaacagcgctgaaatcaacctgcac
aaagactggaagctgatcacactcttcattgggagcaacgacttgtgtcattactgcgag
aatccggaggcccactcagcccaggagtatgtctggcacatccagcaggcactggacatc
ctctaccaggagctgccgagggccttcgtcaacgtggtggaagtcatggagctggctggt
ctgtaccagggccaaggcgacacatgtgtcatgccactggcagcccagagcaactgtgcc
tgcttccgaggctcccaggagaactccctggagatgcaggagctgaagaccgtgaactgg
aacttccagagcagcatctccggcttctccttccggccccagtacctgcagcgggaggac
ttcgcggtggtcgtgcagccgttcttccggcacacgctggcccccctgaacaacagaggg
ggcgctgacctcagcatcttctccgaggactgtctgcacttctctgaacacgggcatgcc
gagctggccatcgctctctggaacaacatgatggaaccagtgggccgtaagacaacctcc
aacaacttcacctacagccgaaccaagctcaagtgcccttctcctgacagcccctacatc
tacaccctgaggaacagtcagctgctccaagataaggctgcagcaggccccaaagagctc
ccctgggccacgccagtggcagcaggatgtggccttgtggttggcattggcaccgtcatg
gcctggagagccctacgacgtcgccagaggggaaatcctccaataagtctgaacactggg
agcttctag

DBGET integrated database retrieval system