KEGG   Sus scrofa (pig): 100519360Help
Entry
100519360         CDS       T01009                                 

Gene name
MYL10
Definition
(RefSeq) myosin regulatory light chain 10
  KO
K12756  myosin regulatory light chain 10
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04510  Focal adhesion
ssc04670  Leukocyte transendothelial migration
ssc04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    100519360 (MYL10)
  Cell motility
   04810 Regulation of actin cytoskeleton
    100519360 (MYL10)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    100519360 (MYL10)
Cytoskeleton proteins [BR:ssc04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     100519360 (MYL10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_8 EFhand_Ca_insen EF-hand_5
Motif
Other DBs
NCBI-GeneID: 100519360
NCBI-ProteinID: XP_005661989
Ensembl: ENSSSCG00000007680
Position
3
AA seq 167 aa AA seqDB search
MAPRRARKRAEGAASSNVFSMFDQSQIQEFKEAFTIMDQNRDGFIDKEDLRDTFAALGRI
NVKNEELEAMVKEAPGPINFTVFLTMFGEKLKGTDPEETILHAFKVFDAEGKGFVKADFI
KEKLMTQADRFSEEEIKQMFAAFPPDVCGNLDYRNLCYVITHGEEKD
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atggcaccaagaagagcccggaaaagagcagaaggcgcggccagctccaacgtcttctcc
atgttcgatcagtctcagatccaggagtttaaagaggctttcaccatcatggaccagaac
cgggacggcttcatcgacaaggaggacctgagggacacctttgctgccctgggtcgcatc
aatgtgaagaacgaggagctggaagccatggtgaaggaggcccccgggcccatcaacttc
acggtctttctgaccatgttcggggagaagctgaagggcacggacccagaggagaccatt
ctccatgccttcaaggtgtttgacgcggaagggaaaggtttcgtcaaggccgacttcatc
aaagagaagctcatgacgcaggcagaccggttcagcgaggaggagatcaagcagatgttt
gcagctttcccaccagatgtgtgtggcaacctggactacaggaacctgtgctatgtcatc
acgcacggcgaagaaaaagactag

DBGET integrated database retrieval system