KEGG   Sus scrofa (pig): 100519360Help
Entry
100519360         CDS       T01009                                 

Definition
myosin regulatory light chain 10-like
Orthology
K12756  
myosin regulatory light chain 10
Organism
ssc  Sus scrofa (pig)
Pathway
Focal adhesion
Tight junction
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100519360
  Cellular commiunity
   04510 Focal adhesion
    100519360
   04530 Tight junction
    100519360
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    100519360
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
3
AA seq 147 aa AA seqDB search
MFDQSQIQEFKEAFTIMDQNRDGFIDKEDLRDTFAALGRINVKNEELEAMVKEAPGPINF
TVFLTMFGEKLKGTDPEETILHAFKVFDAEGKGFVKADFIKEKLMTQADRFSEEEIKQMF
AAFPPDVCGNLDYRNLCYVITHGEEKD
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgttcgatcagtctcagatccaggagtttaaagaggctttcaccatcatggaccagaac
cgggacggcttcatcgacaaggaggacctgagggacacctttgctgccctgggtcgcatc
aatgtgaagaacgaggagctggaagccatggtgaaggaggcccccgggcccatcaacttc
acggtctttctgaccatgttcggggagaagctgaagggcacggacccagaggagaccatt
ctccatgccttcaaggtgtttgacgcggaagggaaaggtttcgtcaaggccgacttcatc
aaagagaagctcatgacgcaggcagaccggttcagcgaggaggagatcaagcagatgttt
gcagctttcccaccagatgtgtgtggcaacctggactacaggaacctgtgctatgtcatc
acgcacggcgaagaaaaagactag

DBGET integrated database retrieval system