KEGG   Sus scrofa (pig): 100519360Help
Entry
100519360         CDS       T01009                                 

Definition
myosin regulatory light chain 10-like
Orthology
K12756  
myosin regulatory light chain 10
Organism
ssc  Sus scrofa (pig)
Pathway
Focal adhesion
Tight junction
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Class
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:ssc04810]
Cellular Processes; Cell communication; Focal adhesion [PATH:ssc04510]
Cellular Processes; Cell communication; Tight junction [PATH:ssc04530]
Organismal Systems; Immune system; Leukocyte transendothelial migration [PATH:ssc04670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
3
AA seq 147 aa AA seqDB search
MFDQSQIQEFKEAFTIMDQNRDGFIDKEDLRDTFAALGRINVKNEELEAMVKEAPGPINF
TVFLTMFGEKLKGTDPEETILHAFKVFDAEGKGFVKADFIKEKLMTQADRFSEEEIKQMF
AAFPPDVCGNLDYRNLCYVITHGEEKD
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgttcgatcagtctcagatccaggagtttaaagaggctttcaccatcatggaccagaac
cgggacggcttcatcgacaaggaggacctgagggacacctttgctgccctgggtcgcatc
aatgtgaagaacgaggagctggaagccatggtgaaggaggcccccgggcccatcaacttc
acggtctttctgaccatgttcggggagaagctgaagggcacggacccagaggagaccatt
ctccatgccttcaaggtgtttgacgcggaagggaaaggtttcgtcaaggccgacttcatc
aaagagaagctcatgacgcaggcagaccggttcagcgaggaggagatcaagcagatgttt
gcagctttcccaccagatgtgtgtggcaacctggactacaggaacctgtgctatgtcatc
acgcacggcgaagaaaaagactag

DBGET integrated database retrieval system