KEGG   Sus scrofa (pig): 100519548Help
Entry
100519548         CDS       T01009                                 

Gene name
AGMAT
Definition
agmatine ureohydrolase (agmatinase)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
ssc  Sus scrofa (pig)
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:ssc00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
6
AA seq 361 aa AA seqDB search
MLQLLVSGCARGLRAGVGVRGLLPLHPASPATGLGNPGLSPSRQASNTPRNQPPKADFVA
RSVGICSMMRLPVQASPEGLDAAFIGVPLDIGTSNRPGARYGPRRIREESVLLRPANPST
GALPFQSLMVADLGDVNVNLYNLQDSCRLIREAYQKIVAAGCIPLTLGGDHTITYPILQA
MSEKHGPVGLVHVDAHMDTADKALGEKLYHGSPFRRCVEEGLLDCKRVVQIGIRGSSLTL
DTYSYSRSQGFRVVLAEDCWLKSLVPLMGEVRQQMGGKPIYISFDIDSLDPAYAPGTGTP
EIAGLTPSQALEIIRGCQGLNVVGCDLVEVSPPYDPFGNTALLAANLLFEMLCVLPKVTV
V
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgcttcagctgctggtttctggctgtgcccgaggcctaagggccggcgtgggcgtgcgg
gggctgcttcccctgcacccagcgagtcctgctacagggcttggcaacccaggcctcagc
ccgagccgccaagcctccaacactccccggaaccagcctcccaaagctgatttcgtggcc
cggtcagtgggcatctgttccatgatgcggctgcccgtgcaggcctcccccgagggactg
gacgctgccttcatcggggtgcccctggacattgggacctccaaccggcccggggcaaga
tatggaccccgacggatccgggaggaatcagtgctgcttcgcccggccaaccccagcacg
ggagccctccccttccagtccctcatggtcgcagacctaggagatgtgaatgtcaacctt
tacaaccttcaggacagctgccgcctcattcgagaggcctatcagaaaatcgtggcagct
ggctgtatccctctgaccttgggtggagatcacaccatcacatatcccatattgcaggcg
atgtcagaaaagcacggccccgtggggctggtgcatgtggacgcgcacatggacacggcg
gacaaggccctgggggagaagctctaccacgggtcgccctttcgccgatgcgtggaggag
ggactcttggactgtaagcgcgtggtgcagattggcatccggggctcttccctgaccttg
gacacctacagctatagccggagccagggctttcgggtggtcctggctgaagactgctgg
ctgaagtcactggttcctctgatgggggaagtgaggcagcagatgggaggcaaacccatt
tatatcagctttgatattgacagcttggatcccgcctatgccccagggacggggacacct
gaaattgctggcctgaccccgagtcaggctctggagatcatccgaggttgtcaaggcctg
aacgtggtgggttgtgatcttgtggaagtttcgccgccatacgatccttttggaaacacg
gccctcctggcggctaacttgctgtttgagatgctgtgtgttctccccaaagtgacagtc
gtctga

DBGET integrated database retrieval system