KEGG   Sus scrofa (pig): 100519930Help
Entry
100519930         CDS       T01009                                 

Definition
(RefSeq) histone H2B subacrosomal variant-like
  KO
K11252  histone H2B
Organism
ssc  Sus scrofa (pig)
Pathway
ssc05034  Alcoholism
ssc05203  Viral carcinogenesis
ssc05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100519930
  Immune diseases
   05322 Systemic lupus erythematosus
    100519930
  Substance dependence
   05034 Alcoholism
    100519930
Chromosome and associated proteins [BR:ssc03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    100519930
Exosome [BR:ssc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100519930
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TauD TFIID_20kDa
Motif
Other DBs
NCBI-GeneID: 100519930
NCBI-ProteinID: XP_003134084
Ensembl: ENSSSCG00000016977
UniProt: F1SK09
Position
16
AA seq 122 aa AA seqDB search
MARYITKKNRCSRGHRHPNSRKKTCSSTECGRRNYSLYVNRVLKEVVPQSGISSRTLDMM
NTVINDIFERISMEASNLMYFRNRCTLTPEDVQKAVYLLLPRKLAKHAVAFGSDAVHRYV
HS
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggccagatacatcaccaaaaagaacaggtgctccagaggacatcgacacccaaactcc
agaaagaagacatgttccagcactgaatgtggccgcagaaattactcactctatgtaaac
agggtcctaaaggaagtggtcccccagagtggcatatcctctcgcaccctggacatgatg
aacaccgtgatcaacgacatctttgagcgcatttccatggaagccagcaacctgatgtat
ttcagaaaccgttgcaccctcacccctgaagatgtccagaaggcagtgtatttgctgttg
cctcggaaactagctaagcatgcagtggcttttggaagtgatgctgtccacagatatgtc
cactcctaa

DBGET integrated database retrieval system