KEGG   Sus scrofa (pig): 100520041Help
Entry
100520041         CDS       T01009                                 

Gene name
USP2
Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 2 isoform X3
  KO
K11833  
ubiquitin carboxyl-terminal hydrolase 2 [EC:3.4.19.12]
Organism
ssc  Sus scrofa (pig)
Brite
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100520041 (USP2)
Peptidases [BR:ssc01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100520041 (USP2)
Ubiquitin system [BR:ssc04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    100520041 (USP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
UniProt: 
Position
9
AA seq 396 aa AA seqDB search
MRTSYTVTLPEEPPAAPFPALAKELRPRSPLSPSLLLSTFVGLLLNKAKNSKSAQGLAGL
RNLGNTCFMNSILQCLSNTRELRDYCLQRLYMRDLSHSSSAHTALMEEFAKLIQTIWTSS
PNDVVSPSEFKTQIQRYAPRFVGYNQQDAQEFLRFLLDGLHNEVNRVTVRPKSSPEGLDH
LPDDEKGRQMWRKYLEREDSRIGDLFVGQLKSSLTCTDCGYCSTVFDPFWDLSLPIAKRG
YPEVTLMDCMRLFTKEDVLDGDEKPTCCRCRARKRCIKKFSVQRFPKILVLHLKRFSESR
IRTSKLTTFVNFPLRDLDLREFASENINHAVYNLYAVSNHSGTTMGGHYTAYCRSPVTGE
WHTFNDSSVSPMSSSQVRTSDAYLLFYELASPPSRM
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgcgcacctcgtacaccgtgaccctgcccgaggagccccccgccgccccctttcctgcc
ctcgccaaggagctgcggccgcgatcccctctctccccttccctgctgctctccaccttc
gtggggctcctgctcaacaaagccaagaactctaagagcgcccagggtctggctggtctt
cgaaaccttgggaacacgtgcttcatgaactccatcctgcagtgcctgagcaacacccgg
gagctgagagactactgcctccagaggctctacatgcgggacctcagccacagcagcagt
gcacacacggccctcatggaagagtttgcaaaactaatccagaccatatggacctcatcc
cccaatgatgtggtgagcccctctgagttcaagacccagatccagagatacgcaccgcgc
ttcgtcggctataatcagcaggacgctcaggagtttcttcgcttccttctggatgggctc
cacaacgaggtgaaccgggtcacagtgaggcccaagtccagtcccgagggcctcgaccat
ctccctgatgatgagaaagggcgccagatgtggaggaaatatctagaacgggaagacagt
cggatcggggatctctttgttgggcagctgaagagctccctgacgtgtacggattgtggt
tactgttctacagtctttgaccccttctgggacctctccctgcccattgctaagcgaggt
tatcccgaggtgactctaatggattgcatgaggctcttcaccaaagaggatgtgctggat
ggcgacgagaagccaacgtgctgtcgctgccgagccagaaaacgctgtataaagaagttc
tccgtccagaggttcccaaagatcttggtgctccatctgaagcggttctcggaatccagg
atacgaaccagcaagctcacaacatttgtgaatttcccactaagagacctggacttgcga
gaatttgcctcagaaaacatcaaccatgctgtttacaacctgtacgctgtgtccaatcac
tccggaaccaccatgggcggccactacacagcctactgccggagtcccgtcacgggcgaa
tggcacactttcaatgactccagcgtctcccccatgtcctccagccaagtgcgcaccagc
gacgcctacttgctcttctacgagttggccagtccgccctcccgcatgtag

DBGET integrated database retrieval system