KEGG   Sus scrofa (pig): 100520164Help
Entry
100520164         CDS       T01009                                 

Gene name
MAP2K5
Definition
mitogen-activated protein kinase kinase 5
Orthology
K04463  
mitogen-activated protein kinase kinase 5 [EC:2.7.12.2]
Organism
ssc  Sus scrofa (pig)
Pathway
MAPK signaling pathway
Gap junction
Neurotrophin signaling pathway
Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100520164 (MAP2K5)
 Cellular Processes
  Cell communication
   04540 Gap junction
    100520164 (MAP2K5)
 Organismal Systems
  Endocrine system
   04921 Oxytocin signaling pathway
    100520164 (MAP2K5)
  Nervous system
   04722 Neurotrophin signaling pathway
    100520164 (MAP2K5)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100520164 (MAP2K5)
Protein kinases [BR:ssc01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   100520164 (MAP2K5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 142 aa AA seqDB search
MSELEILYKCDSSYIIGFYGAFFVENRISICTEFMDGGSLDVYRKIPEHVLGRIAVAVVK
GLTYLWSLKILHRDVKPSNMLVNTRGQVKLCDFGVSTQLVNSIAKTYVGTNAYMAPERIS
GEQYGIHSDVWSLGISFMEEQM
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaattggaaattctctataagtgtgattcatcatatatcatagggttttatggt
gcattttttgtggaaaacaggatttcaatatgtacagaattcatggatggaggatctttg
gatgtatatagaaagattccagagcatgtccttggaagaattgcagtggcggttgttaaa
ggccttacttatttgtggagtttaaagattttacatagagatgtgaagccctccaatatg
ctagtaaacacaaggggacaggtcaagctgtgtgactttggagttagcactcagctagtg
aattctatagccaagacgtatgttggaacaaatgcttatatggcgcctgaaagaatttca
ggggagcagtatggaatccattctgatgtctggagcttaggaatctctttcatggaggag
cagatgtga

DBGET integrated database retrieval system