KEGG   Sus scrofa (pig): 100520418Help
Entry
100520418         CDS       T01009                                 

Gene name
MAP2K7
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 7 isoform X5
  KO
K04431  mitogen-activated protein kinase kinase 7 [EC:2.7.12.2]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04010  MAPK signaling pathway
ssc04012  ErbB signaling pathway
ssc04141  Protein processing in endoplasmic reticulum
ssc04380  Osteoclast differentiation
ssc04530  Tight junction
ssc04620  Toll-like receptor signaling pathway
ssc04660  T cell receptor signaling pathway
ssc04664  Fc epsilon RI signaling pathway
ssc04668  TNF signaling pathway
ssc04722  Neurotrophin signaling pathway
ssc04912  GnRH signaling pathway
ssc04926  Relaxin signaling pathway
ssc05164  Influenza A
ssc05167  Kaposi's sarcoma-associated herpesvirus infection
ssc05169  Epstein-Barr virus infection
ssc05418  Fluid shear stress and atherosclerosis
Module
ssc_M00688  MAPK (JNK) signaling
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100520418 (MAP2K7)
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100520418 (MAP2K7)
   04012 ErbB signaling pathway
    100520418 (MAP2K7)
   04668 TNF signaling pathway
    100520418 (MAP2K7)
 Cellular Processes
  Cellular community - eukaryotes
   04530 Tight junction
    100520418 (MAP2K7)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    100520418 (MAP2K7)
   04660 T cell receptor signaling pathway
    100520418 (MAP2K7)
   04664 Fc epsilon RI signaling pathway
    100520418 (MAP2K7)
  Endocrine system
   04912 GnRH signaling pathway
    100520418 (MAP2K7)
   04926 Relaxin signaling pathway
    100520418 (MAP2K7)
  Nervous system
   04722 Neurotrophin signaling pathway
    100520418 (MAP2K7)
  Development
   04380 Osteoclast differentiation
    100520418 (MAP2K7)
 Human Diseases
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    100520418 (MAP2K7)
  Infectious diseases
   05164 Influenza A
    100520418 (MAP2K7)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    100520418 (MAP2K7)
   05169 Epstein-Barr virus infection
    100520418 (MAP2K7)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100520418 (MAP2K7)
Protein kinases [BR:ssc01001]
 Serine/threonine kinases: STE group
  STE7 family
   100520418 (MAP2K7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase Seadorna_VP7 APH
Motif
Other DBs
NCBI-GeneID: 100520418
NCBI-ProteinID: XP_003123245
Ensembl: ENSSSCG00000013588
UniProt: F1SA79
Position
2
AA seq 419 aa AA seqDB search
MAASSLEQKLSRLEAKLKQENREARRRIDLNLDISPQRPRPTLQLPLANDGGSRSPSSES
SPQHPTPPTRPRHMLGLPSTLFTPRSMESIEIDQKLQEIMKQTGYLTIGGQRYQAEINDL
ENLGEMGSGTCGQVWKMRFRKTGHVIAVKQMRRSGNKEENKRILMDLDVVLKSHDCPYIV
QCFGTFITNTDVFIAMELMGTCAEKLKKRMQGPIPERILGKMTVAIVKALYYLKEKHGVI
HRDVKPSNILLDERGQIKLCDFGISGRLVDSKAKTRSAGCAAYMAPERIDPPDPTKPDYD
IRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEEPPLLPGHMGFSGDFQSFVKDC
LTKDHRKRPKYNKLLEHSFIRRYEALEVDVASWFKDVMAKTESPRTSGVLSQHHLPFFR
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgtcctccctggagcagaagctgtcccgcctggaggcaaagctgaagcaggag
aaccgcgaggcccggcggaggattgacctcaacctggatatcagcccccagcggcccagg
cccaccctgcagctcccactggccaacgatgggggcagccgctcaccatcctctgagagc
tccccgcagcaccccacgcctcccacccggccccgccacatgctggggctcccgtcaacc
ctcttcacaccccgcagcatggagagcattgagattgaccagaagctgcaggagatcatg
aagcagacgggctatctgaccatcgggggccagcgctaccaggcagaaatcaatgatctg
gagaacctgggggagatgggcagcggcacctgcggccaggtgtggaaaatgcgtttccgg
aagaccgggcatgtcattgctgtcaagcaaatgcggcgctcggggaacaaggaggagaac
aagcggatcctcatggacctggacgtggtactcaagagccacgactgcccctacatcgtg
cagtgcttcgggaccttcatcaccaatacggacgtcttcatcgccatggagctcatgggc
acgtgcgctgagaagctcaagaagcggatgcagggccccatccctgagcggatcctgggc
aagatgacagtggcgattgtcaaggcgctttactacctgaaggagaagcacggtgtgatc
catcgcgatgtcaagccctccaacatcctgctggatgagcggggccagatcaagctctgc
gatttcggcatcagtggccgcctcgtcgactccaaggccaaaacgcggagcgcaggctgc
gcagcctacatggcacccgagcgcatcgaccccccggaccctaccaagcctgactacgac
attcgggcagacgtgtggagcttgggcatctccttggtggagctggcgacaggacagttt
ccctacaagaactgcaagacggattttgaggttcttactaaggttctgcaggaagaaccc
ccactcctgcccggtcacatgggcttctcgggggactttcagtcctttgtcaaagactgc
cttactaaagatcacaggaagagaccaaagtataataagctacttgaacacagtttcatc
aggcgctacgaggcgctggaggtggacgtggcatcctggttcaaggatgtcatggcgaag
accgagtcgcctcggacaagcggggtcctgagccagcaccacctgcccttcttcaggtag

DBGET integrated database retrieval system