KEGG   Sus scrofa (pig): 100520418Help
Entry
100520418         CDS       T01009                                 

Gene name
MAP2K7
Definition
mitogen-activated protein kinase kinase 7
Orthology
K04431  
mitogen-activated protein kinase kinase 7 [EC:2.7.12.2]
Organism
ssc  Sus scrofa (pig)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Protein processing in endoplasmic reticulum
Osteoclast differentiation
Toll-like receptor signaling pathway
T cell receptor signaling pathway
Fc epsilon RI signaling pathway
TNF signaling pathway
Neurotrophin signaling pathway
GnRH signaling pathway
Influenza A
Epstein-Barr virus infection
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:ssc04141]
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:ssc04010]
Environmental Information Processing; Signal transduction; ErbB signaling pathway [PATH:ssc04012]
Environmental Information Processing; Signal transduction; TNF signaling pathway [PATH:ssc04668]
Organismal Systems; Immune system; Toll-like receptor signaling pathway [PATH:ssc04620]
Organismal Systems; Immune system; T cell receptor signaling pathway [PATH:ssc04660]
Organismal Systems; Immune system; Fc epsilon RI signaling pathway [PATH:ssc04664]
Organismal Systems; Endocrine system; GnRH signaling pathway [PATH:ssc04912]
Organismal Systems; Nervous system; Neurotrophin signaling pathway [PATH:ssc04722]
Organismal Systems; Development; Osteoclast differentiation [PATH:ssc04380]
Human Diseases; Infectious diseases; Influenza A [PATH:ssc05164]
Human Diseases; Infectious diseases; Epstein-Barr virus infection [PATH:ssc05169]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 419 aa AA seqDB search
MAASSLEQKLSRLEAKLKQENREARRRIDLNLDISPQRPRPTLQLPLANDGGSRSPSSES
SPQHPTPPTRPRHMLGLPSTLFTPRSMESIEIDQKLQEIMKQTGYLTIGGQRYQAEINDL
ENLGEMGSGTCGQVWKMRFRKTGHVIAVKQMRRSGNKEENKRILMDLDVVLKSHDCPYIV
QCFGTFITNTDVFIAMELMGTCAEKLKKRMQGPIPERILGKMTVAIVKALYYLKEKHGVI
HRDVKPSNILLDERGQIKLCDFGISGRLVDSKAKTRSAGCAAYMAPERIDPPDPTKPDYD
IRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEEPPLLPGHMGFSGDFQSFVKDC
LTKDHRKRPKYNKLLEHSFIRRYEALEVDVASWFKDVMAKTESPRTSGVLSQHHLPFFR
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgtcctccctggagcagaagctgtcccgcctggaggcaaagctgaagcaggag
aaccgcgaggcccggcggaggattgacctcaacctggatatcagcccccagcggcccagg
cccaccctgcagctcccactggccaacgatgggggcagccgctcaccatcctctgagagc
tccccgcagcaccccacgcctcccacccggccccgccacatgctggggctcccgtcaacc
ctcttcacaccccgcagcatggagagcattgagattgaccagaagctgcaggagatcatg
aagcagacgggctatctgaccatcgggggccagcgctaccaggcagaaatcaatgatctg
gagaacctgggggagatgggcagcggcacctgcggccaggtgtggaaaatgcgtttccgg
aagaccgggcatgtcattgctgtcaagcaaatgcggcgctcggggaacaaggaggagaac
aagcggatcctcatggacctggacgtggtactcaagagccacgactgcccctacatcgtg
cagtgcttcgggaccttcatcaccaatacggacgtcttcatcgccatggagctcatgggc
acgtgcgctgagaagctcaagaagcggatgcagggccccatccctgagcggatcctgggc
aagatgacagtggcgattgtcaaggcgctttactacctgaaggagaagcacggtgtgatc
catcgcgatgtcaagccctccaacatcctgctggatgagcggggccagatcaagctctgc
gatttcggcatcagtggccgcctcgtcgactccaaggccaaaacgcggagcgcaggctgc
gcagcctacatggcacccgagcgcatcgaccccccggaccctaccaagcctgactacgac
attcgggcagacgtgtggagcttgggcatctccttggtggagctggcgacaggacagttt
ccctacaagaactgcaagacggattttgaggttcttactaaggttctgcaggaagaaccc
ccactcctgcccggtcacatgggcttctcgggggactttcagtcctttgtcaaagactgc
cttactaaagatcacaggaagagaccaaagtataataagctacttgaacacagtttcatc
aggcgctacgaggcgctggaggtggacgtggcatcctggttcaaggatgtcatggcgaag
accgagtcgcctcggacaagcggggtcctgagccagcaccacctgcccttcttcaggtag

DBGET integrated database retrieval system