KEGG   Sus scrofa (pig): 100520499Help
Entry
100520499         CDS       T01009                                 

Gene name
USP49
Definition
ubiquitin specific peptidase 49
Orthology
K11834  
ubiquitin carboxyl-terminal hydrolase 44/49 [EC:3.1.2.15]
Organism
ssc  Sus scrofa (pig)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 682 aa AA seqDB search
MDRCKHVGRLRLAQDHSILNPQKWCCRECATTESVWACLKCSHVACGRYIEDHALKHFEE
TGHPLAMEVRDLYVFCYLCKDYVLNDNPEGDLKLLRSSLLAVRGQTQDLPLRRGRTLRSM
ASGEDAVPPQRAPQGQPQMLTALWYRRQRLLARTLRLWFEKSSRGQAKLEQRRREEALER
KKEAARQRRREVKRRLLEELASAPPRKSARLLLHAPRAAAPRAPAPRAPAGPRPVPRRAP
AMAPGVTGLRNLGNTCYMNSILQVLSHLRKFRECFLNLDPSKTEQLFPRAANGKAPLTGR
LASSSATELSPRSDGAETCEREGLCLNGGASLSRSLELIQNKEPSSKHISLCHELHTLFR
VMWSGKWALVSPFAMLHSVWSLIPAFRGYDQQDAQEFLCELLHKVQQELESEGTTRRILI
PFSQRKLTKQVLKVVNTIFHGQLLSQVTCISCNYKSNTIEPFWDLSLEFPERYHCIEKGF
VPLNQTECLLTEMLAKFTETEALEGRIYACDQCNSKRRKSNPKPLVLSEARKQLMIYRLP
QVLRLHLKRFRWSGRNHREKIGVHVVFDQVLTMEPYCCRDMLSSLDKETFAYDLSAVVMH
HGKGFGSGHYTAYCYNTEGGFWVHCNDSKLNVCSVEEVCKTQAYILFYTQRTVQGNARFS
ETQLQTQVQSSNNNEGRPRTFP
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atggatagatgcaaacatgtagggcggttgcggctcgcccaggaccattccatcctgaac
cctcagaagtggtgctgccgggagtgcgccaccaccgagtccgtgtgggcttgtctcaag
tgctcgcacgtggcctgtggccgctacatcgaggatcacgccctcaaacacttcgaagag
accggacacccgctagccatggaggtccgggatctctacgtgttctgctacctgtgtaag
gactacgtgctcaacgacaacccggagggggacctgaagctgctgagaagctccctcttg
gcggtcaggggccagacgcaggacctgccgctgaggcgcgggcggacgctgcggtccatg
gcctctggcgaggacgccgtcccgccgcagcgcgcccctcagggacagccgcagatgctc
acggctctgtggtaccggcgccagcgcctgctggccaggacgctgcggctctggttcgag
aagagctcgcggggccaggccaagctggagcagcgacggcgggaggaggcgctggagcgc
aagaaggaggcggcgcggcagcggcgacgcgaggtgaagcggcggctgctggaggagctg
gccagcgcccctccgcgcaagagcgcgcgcctgctgctgcacgcgccccgcgccgccgcg
ccgcgcgcacccgccccgcgcgcacccgccgggccccgccccgtcccgcgccgcgcgccc
gccatggccccgggcgtcacgggcctgcgcaacctgggtaacacctgctacatgaactcc
atcctgcaggtgctcagccacctgcgcaagttccgcgagtgcttcctgaacctcgacccg
tccaagacggaacagctgtttcccagggcggccaacggcaaggccccgctcacaggcaga
ctggccagcagctcggccaccgagttgtcgcccaggagcgacggggccgagacctgcgaa
cgcgaaggcctctgcttgaacggcggggcctccctaagcaggagcctcgaactcattcag
aacaaggagcccagctcgaagcacatctccctctgccacgaactgcacaccctcttccgt
gtcatgtggtccgggaagtgggccctggtgtcgcccttcgccatgcttcactccgtgtgg
agcctgatccccgccttcagaggctacgaccagcaggatgcgcaggagtttctttgtgag
ctgttgcacaaagtgcagcaggaactcgagtccgagggcaccacacgccggatcctcatc
cccttctcccagaggaagctcaccaagcaggtcttaaaggtggtgaacaccatatttcac
gggcagctactcagtcaggtcacatgtatatcatgcaattacaaatccaataccattgaa
cccttttgggatctgtccctggaattccctgagcgctatcactgcattgaaaaggggttt
gtccctttgaatcagacagagtgcctgctcactgagatgctggccaagttcacagagaca
gaggccctggaagggagaatctacgcttgtgaccagtgtaacagcaaacgacgaaaatcc
aatccaaaaccccttgttctgagtgaagctagaaagcagttaatgatctacagactacct
caggtcctccggctgcaccttaaaagattcaggtggtctggccgtaatcaccgagagaag
attggggtccatgtcgtctttgaccaggtattaaccatggaaccttactgctgcagggac
atgctctcctctcttgacaaagagacctttgcctatgatctctccgcggtggtcatgcat
cacgggaaagggtttggctcaggacactacacagcctattgctacaacacagagggaggt
ttttgggtccactgcaatgactcaaagctgaatgtatgcagtgtcgaggaagtgtgcaaa
actcaagcctacatccttttttacactcaaagaacagttcagggcaatgcaagattctca
gaaacccaactccaaactcaggtgcagtccagcaacaacaatgagggcagaccacggacc
ttcccctga

DBGET integrated database retrieval system