KEGG   Sus scrofa (pig): 100520654Help
Entry
100520654         CDS       T01009                                 

Gene name
USP11
Definition
ubiquitin specific peptidase 11
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
ssc  Sus scrofa (pig)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Vega: 
Position
X
AA seq 951 aa AA seqDB search
MAVAPWLFGGLCFRFRDQNPEVAVEGPLPIPSCGCCEWRRTAMAAVAASPAAAAEDQELQ
REAVPGLESQRRQIENGENGRGRPLQAGESWFLVEQHWYQKWEEYVQGGDQDSSTSPGCI
NNAGLFEDQVNWRLKKGLVEGEDYVLLPAAAWHYLVNWYGLEHGQPPVERKVVELPGIQK
VEVYPVELLLVQHSDMDTAHTAQFSHTDSLDLVLHTAREQFLVSPQEETRLWIKNAEGSF
ERLCNTHVTVLDAALKTGQVVIMETRNKDGTWPSAQPHAMNSATEEEEDFQGQPGICGLT
NLGNTCFMNSALQCLSNVPQLTEYFLKNRYLEELNFCNPLGMKGEIAEAYADLVKQAWSG
HHRSIVPHVFKTKVGHFASQFLGYQQHDSQELLSFLLDGLHEDLNRVKKKEYVELCDAAG
RPDQEVAQEAWQNHKRRNDSVIVDTFHGLFKSTLVCPDCGNVSVTFDPFCYLSVPLPVSH
KRVMEVFFVSMDPRRKPEQHRLVVPKKGKISDLCVALAKHTGVSPERMMVADVFSHRFYK
IYQLEESLSSILDRDDIFIYEVSGRAAIGENSREDVVLPIYLRERTPARDYNNSYYGLML
FGHPLLVSVPRDRLSWDALYHILLYRLSRYVTRPSSDDEDDGDEKDLEDKDTLPKPGHVA
GSSSQDPGLEQAGPSSGVAGGSRAPVDNSPGPSHWPQRARRKHLFTLQTVNSNGTSDRST
FNEDTHAQPYIAIDWEPEMKKRYYDEVEAEGYVKHDCVGYVLKKAPVRLQECIELFTTVE
TLEKENPWYCPTCKQHQLATKKLDLWMLPETLIIHLKRFSYTKFSREKLDTLVEFPIRDL
DFSEFVIKPQNESAPELYKYDLIAVSNHYGGLRDGHYTTFACNKDSGQWHYFDDNSVSPV
TENQIESKAAYVLFYQRQDVARRLQPQPGFSERPASPACGIPPSSEFMDVN
NT seq 2856 nt NT seq  +upstreamnt  +downstreamnt
atggcagtagccccctggctctttggggggctctgcttccgtttccgggaccagaatccg
gaagtggcagttgaggggcctcttcctatccccagctgcggttgctgtgagtggaggcga
acggctatggcggcggtcgcagcgagtccagcggctgcggccgaggaccaagagctacag
cgcgaagcggtgccgggcctcgagagccagcggcgccagatcgaaaacggcgagaatggg
cgagggcgtccgctgcaggccggcgaaagctggttcctcgtggagcagcactggtaccag
aagtgggaagagtacgtgcagggaggagaccaggactccagcacctcccctggctgcatc
aacaatgctgggctctttgaagaccaggtaaactggcgcctcaagaagggactggtggaa
ggtgaggactatgtgctgctcccagcggctgcttggcattacctggtcaactggtatggt
ctagagcatggccagcctcctgtcgaacgcaaggtcgtggagctgcccggcatccagaag
gtcgaagtgtacccagtagaactgctgcttgtccagcacagtgatatggacacagcccac
actgctcaattcagccacacagattcgctcgacctcgtcttacacaccgcgcgggagcag
tttctggtgagcccccaggaggagacacggctgtggatcaagaacgcagagggctccttt
gagaggttgtgcaacacacacgtcacagtgcttgacgccgctctcaagactgggcaggtg
gtcatcatggagacccgaaacaaggatggcacttggcccagcgcacagccgcacgccatg
aacagcgccacggaggaggaggaggacttccagggccagccaggcatctgcggtctcacc
aatctgggcaacacgtgcttcatgaactcggccctgcagtgcctcagcaacgtgccgcag
ctcaccgagtacttcctcaaaaaccgctacctggaggagctcaacttctgcaacccgctg
ggcatgaagggggagatcgccgaggcctacgcggacctggtgaagcaggcgtggtccggc
caccaccgctccatcgtgccccacgtgttcaagaccaaggtcggccacttcgcgtcccag
tttctgggctaccagcagcatgactcacaggagctgctgtcgttcctcctggatgggctg
cacgaggacctcaaccgtgtcaagaagaaggaatacgtggagctgtgcgatgctgcgggg
aggccagatcaggaggtggctcaggaggcctggcagaaccacaaacggcggaacgattcc
gtgatcgtggacactttccatggcctcttcaagtccacgctggtgtgccccgattgcggc
aacgtgtctgtgacattcgaccccttctgctacctcagtgtcccgctgcctgtcagccac
aagagggtcatggaggtcttcttcgtctccatggacccccgccgcaagccagagcagcac
cggctcgtggtccccaagaaaggcaagatctcggatctgtgtgtggctctggccaaacac
actggcgtctcgccagaaaggatgatggtggccgacgtcttcagtcaccgcttctataag
atctaccagctggaggagtctctgagcagcatcttggacagagatgacatcttcatatac
gaggtgtccggcagggctgccatcggcgagaactccagagaggacgttgtgcttcccatc
tacctgcgggagcgcaccccagcccgggactacaacaactcctactatggcctgatgctc
tttgggcacccgctcctggtgtcggtaccccgggaccgcctctcctgggacgccctgtat
cacatcctgctgtaccgcctctcgcgctacgtgaccagacccagctcggatgacgaggac
gatggtgatgagaaagacctggaggataaggacaccctccctaagcctggacatgtggct
gggagcagctcccaagaccctgggctggagcaggctgggcccagctctggcgtcgcgggc
gggagccgggcccccgtggacaactcccctggaccatctcactggccccagagggcccgg
cgcaagcacctcttcaccctgcagacagtgaactccaacgggaccagcgaccgctcgacc
ttcaacgaggatactcatgcccagccgtacatcgccatcgactgggagccagagatgaag
aagcggtactatgacgaggtggaggccgagggctacgtgaagcatgactgcgtcggctac
gtgctgaagaaggctccggtgcggctgcaggagtgcatcgagctcttcaccactgtggag
accctggagaaggaaaacccctggtactgccccacctgcaagcagcaccagctggccacc
aagaagctggacctgtggatgctgcccgagacgctcatcatccacctgaagcgcttctcc
tacaccaagttctcccgcgagaagctggacactcttgtggagtttcccatccgggacctg
gacttctcggagttcgtcatcaagccgcagaacgagtcggccccagagctgtacaaatac
gatctcatcgcggtttccaaccattacgggggcctgcgtgacggacactacaccacgttc
gcctgcaacaaggacagcggtcagtggcactactttgatgacaacagcgtctcgcccgtg
acggagaatcagatcgagtccaaggcagcctacgtcctcttctaccaacgccaggacgtg
gcccgtcgcctgcagccccagcccggcttctctgagcgccccgcgtcccccgcctgtggt
atcccgcccagctctgagttcatggatgtaaactga

DBGET integrated database retrieval system