KEGG   Sus scrofa (pig): 100520742Help
Entry
100520742         CDS       T01009                                 

Gene name
KMT2B
Definition
(RefSeq) LOW QUALITY PROTEIN: histone-lysine N-methyltransferase 2B
  KO
K14959  
histone-lysine N-methyltransferase MLL4 [EC:2.1.1.43]
Organism
ssc  Sus scrofa (pig)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100520742 (KMT2B)
Enzymes [BR:ssc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100520742 (KMT2B)
Transcription factors [BR:ssc03000]
 Eukaryotic Type
  Zinc finger
   Cys4 Trithorax
    100520742 (KMT2B)
Chromosome [BR:ssc03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100520742 (KMT2B)
   HMT complexes
    MLL3/MLL4 complex
     100520742 (KMT2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
6
AA seq 2719 aa AA seqDB search
MAAAAGGGSCPGPGSARGRFPGRPRGSGGGGGRGGRGSGAERVRVALRRGGGAAGPGGAE
PGEDTALLRLLGLRRGLRRLRRLWAGPRVQRGRGRGRGRGWGPSRGCLLEEESSDGESDD
EEFQGFHSDEDVAPSSLRSALRSQRGRAPRGRGRKHKTTPLPPPRLADVAPTPTKTPARK
RGEEGRERMVQALTELLRRAQAPPAPRSRACESSTPRRSRGRPPGRPAGPCRKKQQAVVV
AEAAVTIPKPEPPPPVVPVKHQTGSWKCKEGPGPGPGTPKRGGQSGRGGRGGRGRGRGGL
PLVIKFVSKAKKVKMGQLSLELESGQGQDQHEESCQEAPQGRVGSGQGEGPCWRKEQKLE
EEGEEDKGKEKDKEQEKEEGEKEEKEEGTVAEQEMVLSEEKEEAKLPSPPLTPPAPPPPP
SLPPPSTSPPSPLCPPPPPVSPPPPSPLPPPAPEEREESPPPVVPATCSRKRGRPPLTPS
QRAEREAARAGPEGTSPPTPVPSTTTGGPLEDTPTVAPKSTTFLKNIRQFIMPVVSARSS
RVIKTPRRFMDEDPPKPPKVEVSPTLRPPVATSPLAPQEPAPAPSPPRAPTPPPTPVPLP
EKRRSILREPTFRWTSLTRELPPPPPAPPPAPPPLPAPVTPSRRPLLLRAPQFTPSEAHL
KIYESVLTTPLGAPEAPEPEPPPADDSPAEPEPRAVGRTNHLSLPRFAPVVATPLKAEVP
PPGALAPSSGQQPQAQLQQPLQAFQTQLLPQALPPQQSQLQPQLQLLPPQQPPPLEKARI
AGLGSLPLSGVEEKMFSLLKRAKVQLIKIDQQQQQKVASLMPPSPGGQMEEVVGTLKQIP
DRGSVKSEDESMEIKRERPSGPESPVQGPRIKHVCRHAAVALGQARAMVPEDVPRLSALP
LRDRQDLAAEDTSSASETESVPSRSRREKVESAGPGGDSEPAGSGGTLAHAPRRSLPSHH
GKKMRMARCGHCRGCLRVQDCGSCVNCLDKPKFGGPNTKKQCCVYRKCDKIEARKMERLA
KKGRTIVKTLLPWDSDESPEASPGPPGPRRGAGAGGPREEVAAPPGPEEQDSLLLQRKSA
RRCVKQRPSYDIFEDSDDSEPGGPPAPRRRTPRENELPVPEPEEQSRPRKPTLQPVLQLK
ARKRPDKDTLAPGTFASFPNGWTGKQKSPDGVHRVRVDFKEDCDLENVWLMGGLSVLTSV
PGGPPMVCLLCASKGLHELVFCQVCCDPFHPFCLEEAERPLPQHHDTWCCRRCKFCHVCG
RKGRGSKHLLECERCRHAYHPACLGPSYPTRATRKRRHWICSACVRCKSCGATPGKNWDV
EWSGDYSLCPRCTQLYEKGNYCPICTRCYEDNDYESKMMQCAQCDHWVHAKCEGLSDEDY
EILSGLPDSVLYTCGPCAGATHPRWREALSGALQGGLRQVLQGLLSSKVAGPLLLCTQCG
QDGKQLHPGPCDLHAVSQRFEEGHYKSVHSFMEDVVGILMRHSEGGETPERRAGGQMKGL
LLKLLESAFGWFDAHDPKYWRRSTRLPNGVLPNAVLPPSLDHVYAQWRQQEPETPESGQP
PGDPSTAFQGKDSAAFSHLEDPRQCALCLKYGDADSKEAGRLLYIGQNEWTHVNCAIWSA
EVFEENDGSLKNVHAAVARGRQMRCELCLKPGATVGCCLSSCLSNFHFMCARASYCIFQD
DKKVFCQKHTDLLDGKEIVTPDGFDVLRRVYVDFEGINFKRKFLTGLEPDAINVLIGSIR
IDSLGTLSDLSDCEGRLFPIGYQCSRLYWSTVDARRRCWYRCRILEYRPWGPREEPVHLE
AAEENQTIVHSPAPSSDPPDHVDPPPDTEALIPRAPEHHSPVQNLDPPLRPDPSSAPPPA
PRSFSGARIKVPNYSPSRRPXGGVSFGPLPSPGSPSSLTHHIPTVGDPDFPAPPRRSRRP
SPLAPRLPPTRRASSPLRTSPQLRVPPPTSVVRALTPTSGELAPPARAPSPPPPEDLGPD
FEDMEVVSGLSAADLDFAASLLGTEPFQEEIVAAGAVGSSHGGPGDSSEEEASPTPRYVH
FPVTVVSSPALVPGALPGTPRIEQLDGVDDGTDSEAEAVQQPRGQGTPPSGPGAGRAGVI
GAVGDRARPPEDLPSEIVDFVLKNLGGPGEGGAGPREEPLPPAPPLANGSQPTQGLPPSP
ADPTRTFAWLPGAPGVRVLSLGPAPEPPKPAASKIILVNKLGQVFVKMAGEGDPVSAPVK
QPPLPPPIPPTAPTSWTLPPGPLLGVLPVVGVVRPAPPPPPPPLTLVLSGGPPSPPRQAI
RVKRVSTFSGRSPPAPPPSKTPRLEEDGESLEDPPQGPGLCGSGFSRVRMKTPTVRGVLD
LDDPGEATGGESPRPLQDRSPLLPLPEGGPPQAPDCPPDLLLESQWHHYSGEASSSEEEP
PSPEDKENQAPKRAGPHLRFEISSEDGFIVEAESLEGAWRTLIEKVQEARGHARLRHLSF
SGMSGARLLGIHHDAVIFLAEQLPGAQRCQHYKFRYHQQGEGQEEPPLNPHGAARAEVYL
RKCTFDMFNFLASQHRVLPEGAACDEEEDEVQLRSTRRATSLELPMAMRFRHLKKTSKEA
VGVYRSAIHGRGLFCKRNIDAGEMVIEYSGIVIRSVLTDKREKFYDGKGIGCYMFRMDDF
DVVDATMHGNAARFINHSCEPNCFSRVIHVEGQKHIVIFALRRILRGEELTYDYKFPIED
ASNKLPCNCGAKRCRRFLN
NT seq 8160 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcggcgggcggcggcagttgccccgggcctggctccgcgcggggccgcttc
ccaggccggccgcggggctccggcgggggcgggggccgcggcggacggggcagcggggcc
gagagagtgcgggtagctctgcggcgcggcggcggcgcggcagggccgggcggagccgag
cccggggaggacacggccctgctccgtttgctggggctccgccggggcctgcgccggctc
cgccgcctgtgggctggcccgcgcgttcagcggggccggggccggggccgaggccgcggc
tggggcccgagccggggctgcctgctggaggaggagagcagtgacggggagtccgacgat
gaggagtttcagggttttcattcagatgaagatgtggcccccagttccctgcgctctgcg
ctccgatcccagcgaggtcgagccccccgaggtcggggccgcaagcataagacgaccccc
cttccgcctcctcgcctagcagatgtggctcctactcccacaaagactcctgctcggaaa
cggggtgaggagggcagagaacggatggtgcaggcactgactgaacttctccggcgggcc
caggcccccccagcccccaggagccgggcatgtgagtcctccaccccccgtcggtctcgg
ggacggcccccaggacggccagcaggcccctgcaggaagaagcaacaagcagtagtggtg
gcagaagcagctgtgacaatccccaaacctgagcccccacctcctgttgttccagtaaaa
caccaaactggcagctggaagtgcaaggaggggcccggcccaggtcctgggacccccaag
cgtggaggacagtctgggcgaggaggccgtggaggcaggggccgaggccgaggtgggctc
cccctcgtgatcaagtttgtttcaaaggccaaaaaagtgaagatgggacaattgtccttg
gaacttgaatcaggtcagggtcaagatcaacatgaggaaagctgccaggaggccccccaa
ggaagagttggatctggacagggagagggcccctgctggagaaaggagcagaagctggag
gaggagggagaggaggacaaaggaaaagagaaagacaaggagcaggagaaggaagaagga
gagaaggaagagaaggaagagggaactgtagctgagcaagagatggtgctatcggaggaa
aaggaagaggcaaagctgccatcaccacccctgactcctccagcccctccacctcctcca
tccctcccacccccctcaacatctcctccatctccactttgccctccaccacccccagtg
tctccacccccaccatcccctctgccacctcctgctccggaggagcgggaagaatcccct
cctcccgtggtcccagctacatgctccaggaagaggggccggcctcccctgactcccagt
cagcgggcagagcgggaagctgctcgggcagggccggagggcacctctcctcccactcca
gtccccagcaccaccacaggaggccctctggaagacacccccactgtggcccccaaaagt
accacctttctgaagaacatccggcagtttattatgcctgtggtgagtgcccgctcctcc
cgtgtcattaagacaccccggcgattcatggatgaagaccctcccaaaccccccaaggtg
gaggtctcacctactctgcggcctcctgttgccacctccccactcgccccccaggaacca
gcaccagccccctctccgccacgtgccccaactcctccgcctaccccagtcccactcccc
gagaagagacggtccatcctgagggaacccacgtttcgctggacctcgctcacccgggag
ctgccccctcctcccccagctcctccaccggccccacccccacttcctgcccctgtcact
ccatctcggaggcccctgctgcttcgggcccctcagtttaccccaagcgaagcccacctg
aagatctacgaatcggtgcttactactcctcttggggcccctgaagcccctgagccagag
cctcctcctgccgacgactctcccgctgagcctgagccacgggcagtgggccgcacgaac
cacctcagcttgcctcgatttgcccctgtggttgctactcctcttaaggccgaggtaccc
cctcctggggctctagctccaagcagtgggcagcagcctcaggctcagctgcagcagccc
ctacaggccttccaaacccagctgctgccccaggcactacccccacagcagtcgcaactg
cagccacagttacagctactgccaccgcagcagccaccaccactggaaaaggcccggatt
gcaggcctgggttccttaccactgtctggtgtggaggagaaaatgttcagccttctcaag
cgagccaaggtgcagctaatcaagattgaccagcagcagcagcagaaggtggcatctttg
atgccgccaagcccaggagggcagatggaggaggtcgtggggactctgaagcagatccca
gatagaggttctgtcaagtctgaagatgaatcgatggaaattaagagagagagaccgtcg
ggccccgagtcccctgtgcaaggcccccgtatcaaacatgtctgccgtcacgctgctgtg
gccctgggtcaggcccgggccatggtgcccgaagatgtcccccgcctcagcgctctccct
ctccgggatcggcaggacctcgccgcggaggatacgtcatcagcgtctgagactgagagt
gtcccgtctcggtcccggcgggaaaaggtggagtcggcagggcctgggggagactcggag
cctgcagggtctggcgggaccctggcccacgccccccggcgctcactgccctcccatcat
ggcaagaagatgcggatggcacggtgtggacactgtcggggctgcctgcgtgtgcaggac
tgcgggtcctgtgtcaactgcctggacaagcccaagtttgggggccccaacaccaagaag
cagtgctgtgtataccggaaatgcgacaagatagaggctcggaagatggaacggctggcc
aaaaaaggccggacgatagtgaagacgctgttgccctgggattccgatgaatctcctgag
gcctcccctggtcctccaggcccacgccggggggcgggagctggggggccccgggaggag
gtggcggcccccccagggcccgaggagcaggactccctcctactgcagcgcaagtcagcc
cggcgctgcgtcaaacagcgaccctcctatgatatcttcgaggactcggatgactcagag
cccgggggcccccctgctcctcggcgtcggaccccccgagagaatgagctgccagtgcca
gaacctgaggagcagagccggccccgcaaacccaccctgcagcctgtgttgcagctcaag
gcccgaaagcgcccagacaaggataccttggctcctggtacctttgcttcttttcccaat
ggctggacgggaaaacaaaagtcccctgatggtgtgcaccgggttcgtgtcgattttaag
gaggattgtgacttggagaacgtgtggctgatgggtggcctaagtgtactcacctccgtg
ccaggggggccaccaatggtgtgcttgttgtgtgccagcaaaggcctgcatgagctggtg
ttctgccaagtctgctgtgaccctttccacccgttctgcctggaggaggctgagcggccc
ctgccccaacatcatgacacttggtgctgccgccgctgcaagttctgccacgtctgtggg
cgcaaaggccggggatctaagcacctcctggagtgtgaacgctgccgccatgcttaccac
ccagcctgcctggggcccagctacccaacccgggccacacgcaaacggcgccactggatc
tgctcagcctgtgtgcgctgtaagagctgtggggcaactccaggcaagaactgggacgtc
gagtggtcgggagattacagcctctgccccaggtgcacccagctctatgagaaaggaaac
tactgcccaatctgcacacgctgctatgaagacaacgattacgagagcaagatgatgcag
tgcgcgcagtgtgaccactgggtgcatgccaagtgcgaggggctctcggatgaagactac
gagatcctttcagggctgccagactcggtgctgtacacctgtggaccgtgtgctggggcc
acacacccccgctggcgagaggccctgagcggggccctgcaggggggcctgcgccaggtg
ctccagggcctgctgagctccaaggtggcaggcccgctgctgctgtgcacccagtgcggg
caggatggaaagcagctgcacccagggccctgcgatcttcacgctgtgagccagcgcttc
gaggaaggccactacaagtccgtgcacagcttcatggaggacgtggtgggcatcctgatg
aggcactcagaagggggagagactccagagcgccgggctggaggccagatgaaggggctc
ctactaaagctgctagagtctgcgttcggctggttcgacgcccacgaccccaagtactgg
cgacggagtacccggttgcccaacggagtccttcccaatgctgtgttgcccccctccttg
gaccatgtctacgctcagtggaggcagcaggaaccagagaccccagaatcagggcagcct
ccaggggacccttcaacagccttccagggcaaggattcagctgcattctcccacctggaa
gacccccgtcagtgtgcgctctgcctcaaatatggggatgcggactcgaaggaggcgggg
cggctcctgtacattgggcagaatgagtggacacacgtcaactgtgccatttggtcagcc
gaagtatttgaagaaaacgatggctccctcaagaacgtgcatgccgctgtggctcgaggg
aggcagatgcgctgtgagctctgcctgaagccgggagccacggtgggctgctgtctctcc
tcctgcctcagcaacttccacttcatgtgtgcccgggccagctactgcatcttccaggat
gacaagaaagttttctgccagaaacacacagacctgctggatggcaaggagatcgtgacc
cctgatggttttgatgttctccgccgagtctatgtggactttgagggcatcaacttcaag
cgaaagttcttgacggggcttgaacccgatgccatcaacgtgctcattggctccatccga
atcgactccttgggcactttgtctgacctctcagactgcgagggacggctcttccccatt
ggctaccagtgctctcgcctgtactggagcacggtagatgctcggcggcgctgctggtat
cggtgccgaattctggagtatcggccgtgggggcccagggaggagccagttcacctggag
gcagcggaggagaaccagaccattgtgcacagccccgccccttcctcagaccccccagat
catgtggaccccccaccagatacagaggcccttatccctagagctcctgagcaccattca
cctgttcagaacctggaccccccacttcggccggatccaagcagcgcccctcctccagcc
ccccgctccttctcgggggctcgaatcaaagtgcccaactactcaccatcccggaggccc
nttgggggtgtctcctttggacccctgccctcccctggaagtccttcttctctgacccac
cacatccctacggtgggagacccggacttcccagctccccccagacgctcccgtcgtcct
agccccctggctcccaggctgcccccaacacggcgggcctcttcccctctcagaacctct
cctcagctcagggtgccccctcctacctcagtcgttagagccctcacacctacctcaggg
gagctggctccccctgcccgggccccatctccaccaccccctgaagacctgggcccagac
tttgaggacatggaggtggtgtcaggactgagtgctgctgacctggactttgcggccagc
ctgctggggactgagcccttccaggaagagattgtggctgcaggggcagtggggagcagc
cacgggggccccggggacagctcagaggaggaggccagccccacgccccgctacgtccac
ttcccagtgactgtggtgtctagccctgccctggtccctggagccctccctggaaccccc
cgcattgagcagctggacggagtggatgacggcacagacagcgaggccgaggcagtccag
cagcctcggggccaggggactccaccttcagggccaggggcaggccgggctggggtcatc
ggggccgtaggggacagggcccggcctcccgaggacttgccatcagaaattgtggatttt
gtgttgaagaacctaggagggcctggggagggaggcgctgggcccagagaggagccactc
cccccagctcctcccctggccaatggcagccagcccactcagggcctcccccctagcccg
gcggaccccactcggacgtttgcctggctccctggggccccaggggtccgggtattgagc
ctgggccctgcccctgagccccccaagcccgccgcatccaagatcatccttgtcaacaag
ctggggcaagtgtttgtgaagatggcgggagagggtgaccctgtctcagccccggtgaag
caaccacctctgccccctcccatcccccccacagcccccacttcctggactctgccccca
ggacccctgctgggtgtgttgccagtggttggggtggtccgccccgccccacccccaccc
cctcctccattgacgctggtgctgagtggtgggccccccagcccgccccgccaggccatc
cgcgtcaaaagggtatccaccttctctggccgttccccaccagcacctcccccaagcaag
actccccggctggaggaagatggagagtccttggaggaccccccccagggtccagggctt
tgtggcagcgggtttagccgagtgaggatgaaaacgcccactgtgcgtggagttcttgac
ctggatgatcctggggaagccactgggggggaaagcccgaggcccctccaggaccggtcc
cctctgctgccacttccagaaggtggtcctccccaggcccctgattgtccccctgacctg
ctgcttgagtcccagtggcaccactactcaggtgaggcttcaagctctgaggaggagcct
ccatccccagaggacaaagagaaccaggcccctaaacgggctggcccgcatctgcgtttc
gagatcagcagtgaggatgggttcatcgtggaggcagagagcctagagggggcgtggaga
actctgattgagaaggtgcaagaggcccgtgggcatgcccggctcagacatctctccttt
agtggaatgagtggggcaaggctcctgggcatccaccatgatgctgtcatcttcctggca
gagcagctgcctggagcccagcgctgccagcactataagttccgctaccaccagcaggga
gagggccaagaggaaccacccctgaatccccatggtgcagcccgcgctgaggtctatctc
cggaagtgcacctttgacatgttcaacttcctggcctcccaacaccgggtgctccctgag
ggagccgcctgtgatgaggaagaggatgaggtgcagctcaggtcaaccagacgcgccacc
agtctggagctgcccatggccatgcgctttcgccacctcaagaagacatccaaagaggct
gtaggtgtctacagatctgccatccatgggcggggcctgttctgtaaacgcaacatcgat
gccggcgagatggtcattgagtactctggtattgtcattcgctctgtgctgactgacaag
cgggagaagttctatgacgggaagggcattgggtgctacatgttccgcatggatgacttt
gacgtggtggatgccaccatgcatggcaatgctgcccgcttcatcaaccactcgtgtgag
cccaactgcttctctcgagtcatccacgtggagggccagaagcacatcgtcatctttgcc
ctgcgccgcatcctgcgtggggaggagctcacctatgactacaagttccccattgaggat
gccagcaacaagctgccctgcaactgtggcgccaagcgctgccgtcggttccttaactga

DBGET integrated database retrieval system