KEGG   Sus scrofa (pig): 100521111Help
Entry
100521111         CDS       T01009                                 

Gene name
PLCD3
Definition
phospholipase C, delta 3
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
ssc  Sus scrofa (pig)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Thyroid hormone signaling pathway
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100521111 (PLCD3)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    100521111 (PLCD3)
   04070 Phosphatidylinositol signaling system
    100521111 (PLCD3)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    100521111 (PLCD3)
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100521111 (PLCD3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
12
AA seq 784 aa AA seqDB search
MLCGLWRSRHRRPEEPPVPAQVAAPVALPSPPAPQDGGTKRPGLRALKKMGLTEDEDVRA
MLQGSTLCKIRSRTWHKERFYRLQEDGLSVWFQRRIRRAPSQHIFYVQHIEAVREGHQSE
GLRRFGGAFAPARCLTIAFKGRRKNLDLAAPTAEEAQRWVRGLAKLRARLDAMNQRERLD
HWIHSYLHRADSNQDSKMSFKEIKSLLLMVNVDMNDMYAYRLFKECDRSNNERLEGPEIE
EFLRRLLKRPELEEIFHRYSGEDRVLSAPELLEFLEDQGEDGATLARAQQLIHTYELNET
AKQHELMTLDGFMMYLLSPEGAALDPAHTGVFQDMNQPLAHYFISSSHNTYLTDSQIGGP
SSTEAYVRAFAQGCRCVELDCWEGPGGEPVIYHGHTLTSKILFRDVVQAVRDHAFTLSPY
PVILSLENHCGLEQQATMARHLRSILGDMLVTQVLDSQNPEELPSPEQLKGRVLVKGKKL
PAARSDEGRILSDREEEEEEEDDEEEAGAAEQRRRAKQISPELSALAVYCGATRLRTLRP
APPPPPPGQVSSLSERKAKKLIREAGNSFVRHNVHQLTRVYPLGLRMNSANYSPQEMWNS
GCQLVALNFQTPGYEMDLNAGRFLINGQCGYVLKPACLRQPDTTFDPECPGPPRTTLTIQ
VLTAQQLPKLNAEKPNSIVDPLVRIEIHGVTSDCARKETNYVLNNGFNPRWGQTLQFQLR
APELALVRFVVEDYDTTSPNDFVGQFTLPLNSLKQGYRHIHLLSKDGASLSPATLFVHIC
IQGS
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
atgctgtgcggcctctggaggagccgccaccggcggccagaggagccccccgtgccggcc
caggtcgcagcgcccgtcgcgctcccgtccccgcccgcgccccaggacggcggcaccaag
aggcccgggctgcgggcgttgaagaagatgggcctgaccgaggacgaggacgtgcgtgcc
atgctgcagggctccacgctctgcaagatccgctcgcggacgtggcacaaggagcggttc
taccggctgcaggaggacggcctgagcgtgtggttccagcggcgcatccggcgcgcgccg
tctcagcacatcttctacgtgcagcacatcgaggccgtccgcgagggccaccagtccgag
ggcctgcgacgcttcgggggcgccttcgcgccggcgcgctgcctcaccatcgccttcaag
gggcgccgcaagaacttggacctggcggcgcccacggccgaggaggcgcagcgctgggtg
cggggtctggccaagctgcgcgcgcgcctcgacgccatgaaccagcgtgagcgcctcgac
cactggatccactcctatctgcaccgggcggactccaaccaggacagtaagatgagcttc
aaggagatcaagagcctgctgctcatggtcaacgtggacatgaacgacatgtacgcctac
cgcctcttcaaggagtgtgaccgctccaacaacgagcggctggaggggcctgagatcgag
gagttcctgcgacggctgctgaaacgcccggagctggaggagatcttccaccggtactcg
ggcgaggaccgcgtgctgagcgcccctgagctgctggagttcctggaggaccagggcgag
gacggcgccacgctggcccgcgcccagcagctcatccacacctatgagctcaacgaaaca
gccaagcagcacgagctgatgaccctggacggcttcatgatgtacctgttgtcacccgag
ggggctgccctggacccagcccacacaggcgtcttccaggacatgaaccagccccttgcc
cactacttcatctcctcctcccacaacacctatctgaccgactctcagatcggcgggccc
agcagcaccgaggcctatgttagggcctttgcccagggatgccgctgcgtggagctggac
tgctgggaggggccaggaggggagcctgtcatctaccacggccacaccctcacctccaag
atcctcttccgagacgtggtccaggctgtgcgtgatcacgccttcacgctgtccccatac
cccgtcatcctgtccctcgagaaccactgcgggctggagcagcaggccaccatggcccgc
cacctccgcagcatccttggggacatgctggtgacgcaggtgctggactcccagaaccct
gaagagctgccatccccagagcagctgaaaggccgggtcctggtgaaggggaagaagctg
ccagccgcgcggagcgatgagggtcggattctctcagaccgggaggaggaggaggaagag
gaggatgacgaagaggaggcgggggctgcagagcagaggcggcgggccaagcagatctcc
ccggagctgtcggccctggccgtgtactgcggcgccacccgcctgcggaccctgcggcct
gccccgcccccgcccccgcccggccaggtcagctccctcagcgagcgcaaggccaagaag
ctcatccgagaggcagggaacagcttcgtcaggcacaacgtccaccagctgacccgcgtc
tacccgctggggctgcggatgaactcggccaactacagtccccaggagatgtggaactcg
ggctgtcagctggtggccctgaacttccagacgccaggttacgaaatggacctcaatgct
gggcgcttcctcatcaatgggcagtgtggctacgtcctgaaacccgcctgcctgcggcag
cctgacacgacctttgaccctgagtgtcctggaccccccagaaccacgctcaccatccag
gtgctgactgcacagcagctgcccaagctgaacgccgagaagccaaactccattgtggac
cccctggtgcgcatcgagatccacggggtgacctcagactgtgcccgcaaggagaccaac
tatgtgctcaacaacggcttcaacccccgctgggggcagaccctgcagttccagctgcgg
gctccggagctggcgctggtccggttcgtggtcgaggattatgacaccacctcccccaat
gactttgtgggccagtttacactgcctctcaacagcctgaagcaagggtaccgccacatc
cacctgctttctaaggacggggcctcgctgtcaccagccacgctctttgtccacatctgc
atccagggctcctga

DBGET integrated database retrieval system