KEGG   Sus scrofa (pig): 100521229Help
Entry
100521229         CDS       T01009                                 

Definition
intestinal-type alkaline phosphatase-like
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
ssc  Sus scrofa (pig)
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ssc00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
15
AA seq 533 aa AA seqDB search
MQGGWVLLLLGLRLPLSLGFIPVEEEDPAFWNRQAAQALDVAKKLQPIQTAAKNLILFLG
DGMGVSTVTATRILKGQMNGKPGPETPLAMDRFPYLALSKTYNVDRQVPDSAGTTTAYLC
GVKTNMKVIGVSAAARYDQCNTTQGNEVISVMNRAKKAGKSVGVVTTTRVQHASPAGAYA
HTVNRNWYSDADLPAEAKKNGCQDISTQLVYNMDIDVILGGGRKYMFPEGTPDPEYPDNP
RQNGVRKDKRNLVQEWQAKHQGARYVWNRTALIQASQDPSLTHLMGLFEPGDMKYEKERD
LSRDPSLVEMTEVALRLLSRNPRGFFLFVEGGRIDHGHHEGIAYRALIETVVFDTAIDKA
GQLTSEEDTLTLVTADHSHVFTYGGYPLRGSSVFGLADGKASDGKAYTSILYGNGPGYKL
SEGARPDVDETKSRDPAYVQQAAVPLGAETHGGEDVAVFARGPRAHLVHGVQEQSFVAHV
MAFAACLEPYTSDCDLPPPSGPTAAGHPGPAACTSLLALLAGALLLLLAPALH
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgcagggcggctgggtgctgctgctgctgggcctgcggctgccgctctcccttggcttc
atcccagttgaggaggaagacccagccttctggaaccgccaggcagcccaggccctggat
gttgccaagaagctgcaacccatccagacggcggccaagaacctcattctctttctgggg
gatggaatgggggtgtccacggtgacggccactcggatcctaaaggggcagatgaatggc
aagccgggacctgagacgcccctggccatggaccgattcccgtacctggctctgtccaag
acatacaacgtggacagacaggtgccagacagcgcaggcaccactaccgcctacctctgc
ggggtcaagaccaatatgaaggtgatcggggtaagcgcggccgcccgctatgaccagtgc
aacacgacccagggcaatgaggtcatctccgtgatgaaccgggccaagaaagcagggaag
tcggtgggagtggtgaccaccacgagggtgcagcatgcctcgccggctggagcctacgcg
cacacggtgaacagaaattggtactccgatgccgacttgcctgcggaggcgaagaagaac
ggctgccaggacatctccacgcagctcgtctacaacatggacatcgatgtgatcctgggt
ggaggccgcaagtacatgtttcctgaggggactccggaccctgaatacccagacaatcca
agacagaacggagttcggaaggacaagcggaacctggtacaggagtggcaggccaagcac
cagggagcccggtatgtgtggaaccgcacggcgctcattcaggcgtcccaggaccccagc
ctaacacacctcatgggcctttttgagccgggagacatgaagtatgaaaaggaacgagac
ctcagcagggacccctccctggtggagatgacggaggtggccctgcgcctgctgagcagg
aacccccgtggcttcttcctcttcgtggagggaggccgcattgaccacggacaccatgaa
ggtatagcttatagggcgctgatcgagactgtcgtgtttgacaccgccatcgacaaggct
ggccagctcactagcgaagaggacacactgaccctggtcacggccgaccactctcatgtc
ttcacctatggtggctacccgctgcgtggaagctccgtttttgggctggctgatggcaag
gcctctgatggcaaagcctacacctccatcctttatggcaatggcccgggatacaagctc
agcgaaggcgcaaggcctgatgttgatgaaaccaagagcagggaccccgcatacgtgcag
caggcggccgtgcccctgggtgccgagacccacggtggcgaggacgtggcggtgttcgcg
cgcggcccccgggcgcacctggtgcacggcgtgcaggagcagagcttcgtggcgcacgtg
atggccttcgccgcctgcctggagccctacaccagcgactgcgacttgccgcccccctct
ggccccaccgccgccgggcaccctgggccggccgcctgcacctcgctgctggcgctgctg
gcgggggcgctgctgctgctgctggcgcccgccctgcactga

DBGET integrated database retrieval system