KEGG   Sus scrofa (pig): 100521252Help
Entry
100521252         CDS       T01009                                 

Gene name
CLK4
Definition
CDC-like kinase 4
Orthology
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
ssc  Sus scrofa (pig)
Brite
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     100521252 (CLK4)
Protein kinases [BR:ssc01001]
 Serine/threonine protein kinases: CMGC group
  CLK family
   100521252 (CLK4)
Spliceosome [BR:ssc03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    100521252 (CLK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 481 aa AA seqDB search
MRHSKRTHCPDWDSRESWGHESYSGSHKRKRRSHSSTQENRHCKPHHQFKESDCHYLEAR
SLNERDYRDRRYIDEYRNDYCERYVPRHYHRDIESSYRIHCSKSSVRSRRSSLKRKRNRH
CSSHQSRSKSHRRKRSRSIEDDEEGHLICQSGDVLRARYEIVDTLGEGAFGKVVECIDHG
MDGMHVAVKIVKNVGRYREAARSEIQVLEHLNSTDPNSVFRCVQMLEWFDHHGHVCIVFE
LLGLSTYDFIKENSFLPFQIDHIRQMAYQICQSINFLHHNKLTHTDLKPENILFVKSDYV
VKYNSKMKRDERTLKNTDIKVVDFGSATYDDEHHSTLVSTRHYRAPEVILALGWSQPCDV
WSIGCILIEYYLGFTVFQTHDSKEHLAMMERILGPIPTHMIQKTRKRKYFHHNQLDWDEH
SSAGRYVRRRCKPLKEFMLCHDEEHEKLFDLVRRMLEYDPVKRITLDEALQHPFFDLLKK
K
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgcggcattccaaaagaactcactgccctgattgggatagcagagaaagctggggacat
gaaagctacagtggaagtcacaaacggaagaggagatcccacagtagtacacaagagaac
agacattgtaaaccacatcaccagtttaaagaatctgattgtcattatttagaagcaagg
tccttgaatgagagagattatcgggaccggagatacattgatgaatacagaaatgactac
tgcgaaagatatgttcctagacattatcacagagacattgaaagcagttatcgaatccat
tgcagtaaatcttcagtccgaagcaggagaagcagtcttaaaaggaaacgtaatagacac
tgttcaagtcatcagtcacgttcgaagagccaccgaaggaaaagatccaggagtatagag
gatgatgaggagggtcacctgatctgtcaaagtggagacgttctaagagcaagatatgaa
atcgtggacactttgggtgaaggggcctttggcaaagttgtagagtgcattgatcatggc
atggatggcatgcatgtagcagtgaaaattgtaaaaaatgtgggtcgatatcgtgaagca
gctcgttcagaaatccaagtattggagcatttaaatagtactgatcccaatagtgtcttc
cgatgtgtccagatgctagaatggtttgatcatcatggtcatgtttgtattgtgtttgaa
ctactgggacttagtacctatgatttcattaaagaaaatagctttctgccatttcaaatt
gaccacatcaggcaaatggcatatcagatctgtcagtcaataaattttctgcatcataat
aaattaacccatacagatctgaagcctgaaaatattttatttgtgaagtctgactatgta
gtcaaatataattctaaaatgaaacgtgatgaacgcacactgaaaaacacagatatcaaa
gttgttgattttggaagtgcaacatacgatgatgaacatcatagtactttggtatctaca
cggcattacagagccccagaggtcattttagctttaggttggtctcagccttgtgatgtt
tggagcataggttgcattcttattgaatattaccttggtttcacagtctttcagactcat
gatagtaaagagcacctggcaatgatggaacgaatattaggacccataccaacacacatg
attcagaaaacaagaaaacgcaagtattttcatcataaccagctagattgggatgaacat
agttctgctggtagatatgttaggagacgctgcaaaccattaaaggagtttatgctttgt
catgatgaagaacatgagaaactgtttgacctggttcgaagaatgttagaatatgatcct
gtgaaaagaattaccttggatgaagcattgcagcatcctttctttgacttattaaaaaag
aaatga

DBGET integrated database retrieval system