KEGG   Sus scrofa (pig): 100521281Help
Entry
100521281         CDS       T01009                                 

Gene name
PAICS
Definition
phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase
Orthology
K01587  
phosphoribosylaminoimidazole carboxylase / phosphoribosylaminoimidazole-succinocarboxamide synthase [EC:4.1.1.21 6.3.2.6]
Organism
ssc  Sus scrofa (pig)
Pathway
Purine metabolism
Metabolic pathways
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    100521281 (PAICS)
Enzymes [BR:ssc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.21  phosphoribosylaminoimidazole carboxylase
     100521281 (PAICS)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.6  phosphoribosylaminoimidazolesuccinocarboxamide synthase
     100521281 (PAICS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
8
AA seq 451 aa AA seqDB search
MLSPGRHYLSPPSCAVAAAAPSPLRTMATAEVLNIGKKLYEGKTKEVYELLDSPGKVLLQ
SKDQITAGNAARKNHLEGKAAISNTITSCVFQLLQEAGIKTAFTRKCGETAFIAPKCEMI
PIEWVCRRIATGSFLKRNPGVKEGYKFYPPKVEMFFKDDANNDPQWSEEQLIAANFCFAG
LVIGQTEVDVMSHATQAIFEILEKSWLPQNCTLVDMKIEFGVDVTTKEIVLADVIDNDSW
RLWPSGDRSQQKDKQSYRDLKEVTPEGLQMVKKNFEWVAERVELLLKTESQCRVVVLMGS
TSDLSHCEKIKKACGNFGIPCELRVTSAHKGPDETLRIKAEYEGDGIPTVFVAVAGRSNG
LGPVMSGNTAFPVISCPPLSPDWGAQDVWSSLRLPSGLGCSTILSPEGSAQFAAQIFGLN
NHLVWAKLRANVLNTWISLKQADKKIREGNL
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgctttcccctgggcgtcactacttgagtcctccctcttgtgcagtcgctgcagctgcc
cccagcccgctccggacaatggcgacggctgaggtactgaacattggtaagaaactctac
gagggtaaaacaaaagaagtctatgaattgttggatagtccaggaaaagtcctcctgcag
tccaaggaccagattacagcaggaaatgcagccagaaaaaatcaccttgaaggaaaagct
gccatctcaaacacaatcaccagctgtgtttttcagttgttacaggaagcaggtatcaag
actgctttcaccagaaaatgtggggagacggctttcattgcacctaagtgtgaaatgatt
ccaattgaatgggtttgtagaagaatagcaactggttcttttctcaaaagaaaccctggt
gtcaaggaaggctataagttctacccacctaaagtagagatgtttttcaaggatgacgcc
aataatgacccacagtggtctgaggaacagctcattgctgcaaatttttgctttgctgga
cttgttataggccagactgaagtggatgtcatgagtcatgctacacaggccattttcgaa
atactggagaaatcctggctgccccagaactgtacactggttgatatgaagattgaattt
ggtgttgatgtaaccacgaaagaaattgttcttgctgatgtcattgataatgactcctgg
agactctggccatcaggagatcgaagccaacagaaagacaaacagtcctatcgtgacctc
aaggaagtaacgcctgaagggctgcagatggtaaagaagaactttgagtgggttgcagag
agagtagagttgcttctgaaaacagaaagtcagtgcagagttgtagtattgatgggctcg
acctctgatcttagtcactgtgaaaaaattaagaaggcttgtgggaatttcggcattcca
tgtgaacttagggtaacatctgcccataaaggaccagatgaaactctaaggattaaagct
gagtatgaaggggatggcatccctaccgtgtttgtggcagtggcgggcagaagcaatggt
ctgggaccagtgatgtctggtaacactgcatttccagttattagctgtccccccctcagt
ccagactggggggcacaggatgtgtggtcttctcttcgattacccagcggtcttggctgt
tcaaccatactttctccagaaggatcagctcagtttgctgctcagatatttggattaaat
aaccatttggtatgggccaagctacgagcaaacgtattaaacacatggatttccttgaag
caggctgacaagaaaatcagagagggcaatttatga

DBGET integrated database retrieval system