KEGG   Sus scrofa (pig): 100521736Help
Entry
100521736         CDS       T01009                                 

Gene name
MAPK10
Definition
(RefSeq) mitogen-activated protein kinase 10 isoform X3
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc01522  Endocrine resistance
ssc04010  MAPK signaling pathway
ssc04012  ErbB signaling pathway
ssc04014  Ras signaling pathway
ssc04024  cAMP signaling pathway
ssc04068  FoxO signaling pathway
ssc04071  Sphingolipid signaling pathway
ssc04137  Mitophagy - animal
ssc04140  Autophagy - animal
ssc04141  Protein processing in endoplasmic reticulum
ssc04210  Apoptosis
ssc04215  Apoptosis - multiple species
ssc04217  Necroptosis
ssc04310  Wnt signaling pathway
ssc04380  Osteoclast differentiation
ssc04510  Focal adhesion
ssc04530  Tight junction
ssc04620  Toll-like receptor signaling pathway
ssc04621  NOD-like receptor signaling pathway
ssc04622  RIG-I-like receptor signaling pathway
ssc04625  C-type lectin receptor signaling pathway
ssc04657  IL-17 signaling pathway
ssc04658  Th1 and Th2 cell differentiation
ssc04659  Th17 cell differentiation
ssc04664  Fc epsilon RI signaling pathway
ssc04668  TNF signaling pathway
ssc04722  Neurotrophin signaling pathway
ssc04723  Retrograde endocannabinoid signaling
ssc04728  Dopaminergic synapse
ssc04750  Inflammatory mediator regulation of TRP channels
ssc04910  Insulin signaling pathway
ssc04912  GnRH signaling pathway
ssc04914  Progesterone-mediated oocyte maturation
ssc04917  Prolactin signaling pathway
ssc04920  Adipocytokine signaling pathway
ssc04926  Relaxin signaling pathway
ssc04930  Type II diabetes mellitus
ssc04931  Insulin resistance
ssc04932  Non-alcoholic fatty liver disease (NAFLD)
ssc04933  AGE-RAGE signaling pathway in diabetic complications
ssc05132  Salmonella infection
ssc05133  Pertussis
ssc05142  Chagas disease (American trypanosomiasis)
ssc05145  Toxoplasmosis
ssc05152  Tuberculosis
ssc05160  Hepatitis C
ssc05161  Hepatitis B
ssc05164  Influenza A
ssc05167  Kaposi's sarcoma-associated herpesvirus infection
ssc05168  Herpes simplex infection
ssc05169  Epstein-Barr virus infection
ssc05200  Pathways in cancer
ssc05210  Colorectal cancer
ssc05212  Pancreatic cancer
ssc05231  Choline metabolism in cancer
ssc05418  Fluid shear stress and atherosclerosis
Module
ssc_M00688  MAPK (JNK) signaling
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100521736 (MAPK10)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100521736 (MAPK10)
   04010 MAPK signaling pathway
    100521736 (MAPK10)
   04012 ErbB signaling pathway
    100521736 (MAPK10)
   04310 Wnt signaling pathway
    100521736 (MAPK10)
   04668 TNF signaling pathway
    100521736 (MAPK10)
   04068 FoxO signaling pathway
    100521736 (MAPK10)
   04071 Sphingolipid signaling pathway
    100521736 (MAPK10)
   04024 cAMP signaling pathway
    100521736 (MAPK10)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    100521736 (MAPK10)
   04137 Mitophagy - animal
    100521736 (MAPK10)
  Cell growth and death
   04210 Apoptosis
    100521736 (MAPK10)
   04215 Apoptosis - multiple species
    100521736 (MAPK10)
   04217 Necroptosis
    100521736 (MAPK10)
  Cellular community - eukaryotes
   04510 Focal adhesion
    100521736 (MAPK10)
   04530 Tight junction
    100521736 (MAPK10)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    100521736 (MAPK10)
   04621 NOD-like receptor signaling pathway
    100521736 (MAPK10)
   04622 RIG-I-like receptor signaling pathway
    100521736 (MAPK10)
   04625 C-type lectin receptor signaling pathway
    100521736 (MAPK10)
   04658 Th1 and Th2 cell differentiation
    100521736 (MAPK10)
   04659 Th17 cell differentiation
    100521736 (MAPK10)
   04657 IL-17 signaling pathway
    100521736 (MAPK10)
   04664 Fc epsilon RI signaling pathway
    100521736 (MAPK10)
  Endocrine system
   04910 Insulin signaling pathway
    100521736 (MAPK10)
   04920 Adipocytokine signaling pathway
    100521736 (MAPK10)
   04912 GnRH signaling pathway
    100521736 (MAPK10)
   04914 Progesterone-mediated oocyte maturation
    100521736 (MAPK10)
   04917 Prolactin signaling pathway
    100521736 (MAPK10)
   04926 Relaxin signaling pathway
    100521736 (MAPK10)
  Nervous system
   04728 Dopaminergic synapse
    100521736 (MAPK10)
   04723 Retrograde endocannabinoid signaling
    100521736 (MAPK10)
   04722 Neurotrophin signaling pathway
    100521736 (MAPK10)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100521736 (MAPK10)
  Development
   04380 Osteoclast differentiation
    100521736 (MAPK10)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100521736 (MAPK10)
   05231 Choline metabolism in cancer
    100521736 (MAPK10)
   05210 Colorectal cancer
    100521736 (MAPK10)
   05212 Pancreatic cancer
    100521736 (MAPK10)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    100521736 (MAPK10)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    100521736 (MAPK10)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100521736 (MAPK10)
   04931 Insulin resistance
    100521736 (MAPK10)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100521736 (MAPK10)
  Infectious diseases
   05132 Salmonella infection
    100521736 (MAPK10)
   05133 Pertussis
    100521736 (MAPK10)
   05152 Tuberculosis
    100521736 (MAPK10)
   05164 Influenza A
    100521736 (MAPK10)
   05161 Hepatitis B
    100521736 (MAPK10)
   05160 Hepatitis C
    100521736 (MAPK10)
   05168 Herpes simplex infection
    100521736 (MAPK10)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    100521736 (MAPK10)
   05169 Epstein-Barr virus infection
    100521736 (MAPK10)
   05145 Toxoplasmosis
    100521736 (MAPK10)
   05142 Chagas disease (American trypanosomiasis)
    100521736 (MAPK10)
  Drug resistance
   01522 Endocrine resistance
    100521736 (MAPK10)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100521736 (MAPK10)
Protein kinases [BR:ssc01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100521736 (MAPK10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like RIO1 APH FTA2 Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 100521736
NCBI-ProteinID: XP_003129389
Ensembl: ENSSSCG00000009228
Vega: OTTSUSG00000001581
Position
8
AA seq 464 aa AA seqDB search
MSLHLLYYCSEPTLDVKIAFCQGFDKQVDVSYIAKHYNMSKSKVDNQFYSVEVGDSTFTV
LKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNH
KNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHL
HSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGY
KENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRNYVEN
RPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISVDDALQHPYIN
VWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMLSEEKTKNGVVKGQPSPSGAA
VNSSESLPPSSSVNDISSMSTDQTLASDTDSSLEASAGPLGCCR
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgagcctccatttattgtactactgcagtgaaccaaccttggatgtgaaaattgccttt
tgtcagggattcgataaacaagtggatgtgtcatatattgccaaacattacaacatgagc
aaaagcaaagttgacaaccagttctacagtgtggaagtgggagactcaaccttcacagtt
ctcaagcgctaccagaatctaaagccgattggctctggggctcagggaatagtttgtgct
gcctatgacgctgttcttgacagaaatgtggccattaagaagctcagcagaccctttcag
aaccaaactcatgccaagagagcttaccgggagctggtcctcatgaaatgtgtgaaccat
aaaaacattattagtttattaaatgtcttcacaccccagaagacgctggaggagtttcaa
gatgtttacttagtgatggaactgatggatgccaacttgtgtcaggtgattcagatggag
ttagaccatgagcgaatgtcttacctgctataccaaatgttatgtggcatcaagcacctt
cactctgctgggattattcacagggacttaaaaccaagtaacattgtagtcaagtctgat
tgtacactgaaaatcctggactttggcctggccaggacagcaggcacaagcttcatgatg
actccttatgtggtgacacgttattacagggcccccgaggtcattctaggaatgggctac
aaggaaaatgtggatatatggtctgtgggatgcattatgggagaaatggttcgtcacaaa
atcctctttccaggaagggactatattgaccagtggaacaaggtaattgagcagctggga
acgccatgtccagaattcatgaagaaattacaacccacggtaagaaactatgtggagaat
cgacccaagtacgcaggactcaccttccccaagctcttcccagattccctcttcccagcg
gactccgagcacaataaactcaaagccagccaagccagggacttgttgtcaaagatgcta
gtgattgacccagcaaaaaggatatcagtggatgacgccttacagcatccgtatatcaat
gtctggtacgaccctgctgaagtggaggcgcctccgcctcagatatatgacaaacagctg
gatgagagagaacacaccatcgaagaatggaaagaactcatctacaaggaggtgatgctt
tcggaagagaagacgaagaacggcgtcgtgaaaggccagccctctccctcaggtgcagca
gtgaacagcagtgagagtctccctccttcctcttctgtcaacgacatctcctccatgtcc
accgaccagaccctggcatccgacactgacagcagcctggaagcctcggcgggacccctg
ggttgttgcaggtga

DBGET integrated database retrieval system