KEGG   Sus scrofa (pig): 100521756Help
Entry
100521756         CDS       T01009                                 

Gene name
ALPI
Definition
alkaline phosphatase, intestinal
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
ssc  Sus scrofa (pig)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    100521756 (ALPI)
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     100521756 (ALPI)
Exosome [BR:ssc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100521756 (ALPI)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
15
AA seq 533 aa AA seqDB search
MQGGWVLLLLGLRLPLSLGFIPVEEEDPAFWNRQAAQALDVAKKLQPIQTAAKNLILFLG
DGMGVPTVTATRILKGQMNGKPGPETPLAMDRFPYLALSKTYNVDRQVPDSAGTATAYLC
GVKANYQTIGLSAAARYNQCNTTQGNEVISVMNRAKKAGKSVGVVTTTRVQHASPAGTYA
HTVNRNWYSDVNLPAEAQAQGCQDIATQLVYNMDIDVILGGGRKYMFPEGTPDPEYPDDA
SQNGVRKDKRNLVQEWQDKYQGARYVWNRRTFLQAAQDPSVTHLMGLFEPADMKFEAERD
VSMDPSLEEMTEMALQMLSRNPRGFYLFVEGGRIDHGHHEGIAYMALTESVMFDTAIDKA
GQLTSEKDTLILVTADHSHVFSFGGYTLRGSSVFGLAPSKALDLKPYTSILYGNGPGYAL
NGSSRPSVTGSEISDRMYRQQAAVPLESETHGGEDVAVFARGPQAHLVHGVQEQSFVAHV
MAFAACLEPYTDCNLRPPEGLSNAAHPRPVACPPSLLLLLAGALLLLLMPALH
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgcagggcggctgggtgctgctgctgctgggcctgcggctgccgctctcccttggcttc
atcccagttgaggaggaagacccagccttctggaaccgccaggcagcccaggccctggat
gttgccaagaagctgcaacccatccagacggcggccaagaacctcattctctttctgggg
gatgggatgggggtgcccacggtgacagccactcggatcctaaaggggcagatgaatggc
aagccgggacctgagacgcccctggccatggaccgattcccgtacctggctctgtccaag
acatacaacgtggacagacaggtgccagacagcgcaggcacggccaccgcctacctctgc
ggggtcaaggccaactaccagaccatcggtttaagcgcggccgcccgctataaccagtgc
aacacgacccagggcaatgaggtcatctccgtgatgaaccgggccaagaaagcagggaag
tcggtgggagtggtgaccaccacgagggtgcagcatgcctcgccggctggtacctatgca
cacacggtgaacagaaattggtactccgatgtcaacttgcctgccgaggcacaggcacag
ggctgccaggacatcgccactcagctcgtctacaacatggacatcgatgtgatcctgggt
ggaggccgcaagtacatgtttccagaggggaccccggaccctgaatacccagacgatgcc
agtcagaacggagttcggaaggacaagcggaacctggtacaggagtggcaggacaagtac
cagggagcccggtatgtgtggaaccgcaggacattccttcaggccgcccaggaccccagc
gtaacacacctcatgggcctctttgagccggcagacatgaaatttgaggccgagcgagac
gtcagcatggacccctccttggaggagatgacagagatggccctgcagatgctgagcagg
aacccccgtggcttctacctcttcgtggagggaggccgcattgaccacggacaccacgag
ggcatagcctacatggctctgaccgagagtgtcatgtttgacaccgccatcgacaaggct
ggccagctcactagcgaaaaggacacacttatcctggtcacggccgaccactctcatgtc
ttctcttttggtggctacacattgcgtggaagctccgtttttggcctggcccccagcaag
gccttggatctcaagccatatacctccatcctttatggcaacggcccgggctatgctctg
aatggaagctcaagacccagcgtcactgggagcgagattagcgaccgcatgtaccggcag
caggcggccgtgcccctggaaagcgagacccacggcggcgaggatgtggcggtgttcgcg
cgcggcccgcaggcgcacctggtgcacggcgtgcaagagcagagcttcgtggcgcacgtg
atggccttcgccgcctgcctggagccctacaccgactgcaacttacggccgccagaaggt
ctttccaacgccgcacaccccaggccggtggcctgcccaccttcgctgctgctgctgctg
gcgggggcactgctgctgctgctgatgcccgccctgcactga

DBGET integrated database retrieval system