KEGG   Sus scrofa (pig): 100522086Help
Entry
100522086         CDS       T01009                                 

Gene name
ART3
Definition
ADP-ribosyltransferase 3 (EC:2.4.2.31)
Orthology
K00775  
NAD(P)-arginine ADP-ribosyltransferase [EC:2.4.2.31]
Organism
ssc  Sus scrofa (pig)
Brite
Enzymes [BR:ssc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     100522086 (ART3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Vega: 
UniProt: 
Position
8
AA seq 381 aa AA seqDB search
MKTGHFEMVTILLAPVILMDIFQVKAEMLDMADNAFDDEYLKCTDRMEIKYVPQLLKEEK
ASLQLLEDVWENAKAKWETRKTRLFLPVAFKDNHGIALMAYISEAQEQTAFYHLFNEAVK
MAGQSRKDYVYGFQFKAFHFYLTKALQLLRSCEKSYKNVVYSISQNTSFTFGGLNQARLG
HFTLAYSAKPQAATHQHILLTIRTCFGVAIETFSDKESETIILIPLNEVFHVSQDGTSNN
LILQSTNKTCSHYECAFLGGLKTADCVENMEYFQPIYVYNPGEKNQKLEEPGMKSQDSTV
SPGVKSQEATQIPRMKIPEPFSVPEGKNQDINNPTPAPAPGPGPGPGPKTHHFASSGKML
LPTLGTFILVGASTINPFTAL
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaagacaggacattttgaaatggtcaccatactgctggcacctgtgattctaatggac
atcttccaggtaaaggctgaaatgttagatatggcagataatgcatttgatgatgaatac
ctgaaatgcacagacaggatggaaatcaaatatgttccccagttgctcaaggaggaaaaa
gcaagcctccagctcttggaagatgtgtgggaaaatgcaaaagccaaatgggaaactcgg
aagactcggctctttctccctgtggcttttaaggataaccatggaatagctctgatggca
tatatttctgaagctcaagagcaaactgccttttatcatctgttcaatgaagctgtgaaa
atggctggccaatctcgaaaagattatgtctatggcttccagttcaaagcttttcatttt
tacctgacaaaagccctgcagttgctgagatcttgtgagaagagttacaaaaatgtggtg
tatagcataagccagaatacttcatttacatttggagggctaaaccaagccagattgggc
catttcactttggcatattcagccaaacctcaagctgctactcaccaacacatcctgtta
accatccgtacgtgctttggagttgccattgaaacattttctgataaagaaagtgaaaca
attattttaatacctctgaatgaggtttttcatgtgtcacaagatgggactagcaataat
cttatccttcaaagcacaaacaagacctgcagccattacgagtgtgcgtttctaggtgga
ctgaaaactgcagattgtgttgagaacatggaatattttcaacccatctatgtctacaac
cctggtgagaaaaaccagaagcttgaagaacctggaatgaaaagccaggattccactgtc
tcgcctggtgtgaagagccaagaagccacccaaatacctagaatgaaaattccagaacct
ttctcagtacctgaaggcaaaaatcaagatatcaacaatcctactccagctccagctcca
ggtccaggtccaggcccaggtcccaaaacccatcactttgcatcttctggcaaaatgctc
cttccaacacttggaacattcattttagtcggtgcctctactataaatccctttactgcg
ctgtag

  All links  
No link information was found.   
DBGET integrated database retrieval system