KEGG   Sus scrofa (pig): 100522196Help
Entry
100522196         CDS       T01009                                 

Gene name
USP46
Definition
ubiquitin specific peptidase 46
Orthology
K11842  
ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.4.19.12]
Organism
ssc  Sus scrofa (pig)
Brite
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100522196 (USP46)
Peptidases [BR:ssc01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100522196 (USP46)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
8
AA seq 361 aa AA seqDB search
MRMNCFQGTNASALEKDIGPEQFPINEHYFGLVNFGNTCYCNSVLQALYFCRPFRENVLA
YKAQQKKKENLLTCLADLFHSIATQKKKVGVIPPKKFISRLRKENDLFDNYMQQDAHEFL
NYLLNTIADILQEEKKQEKQNGKLKNGNMNEPAENNKPELTWVHEIFQGTLTNETRCLNC
ETVSSKDEDFLDLSVDVEQNTSITHCLRDFSNTETLCSEQKYYCETCCSKQEAQKRMRVK
KLPMILALHLKRFKYMEQLHRYTKLSYRVVFPLELRLFNTSSDAVNLDRMYDLVAVVVHC
GSGPNRGHYITIVKSHGFWLLFDDDIVEKIDAQAIEEFYGLTSDISKNSESGYILFYQSR
E
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgaggatgaattgtttccagggcaccaatgcctctgctctggaaaaagacattggtcca
gagcagtttccaatcaatgaacactacttcggattggtcaatttcggaaacacctgctac
tgtaactctgtgcttcaggccttgtacttctgccggcctttccgggagaatgtgctggca
tacaaggcccagcaaaaaaagaaggaaaacttgttgacgtgcctggcagaccttttccac
agcatcgccacgcagaagaagaaagtcggcgtgatcccaccaaagaagttcatttcgcgg
ctgagaaaagaaaatgatctctttgataactacatgcagcaggatgctcacgagtttcta
aattatttgctaaacactattgcggacatcctgcaggaagagaagaagcaggagaaacaa
aatgggaaattaaaaaatggcaacatgaacgaacctgcggagaataataaaccagaactc
acctgggtccatgagatctttcagggaacgctcaccaatgagactcgatgcttgaactgt
gaaactgttagtagcaaagatgaagattttcttgatctttctgtcgacgtggagcagaat
acatccatcacccactgtctcagagacttcagcaacacagaaacgctgtgtagtgaacag
aagtattattgtgaaacatgctgcagcaaacaggaggcccagaaaaggatgagagtcaaa
aagctgcccatgattttggccctgcacctcaagcgattcaagtacatggagcagctccac
aggtacaccaagctgtcctaccgtgtggtcttcccgctggaactccggctcttcaacacc
tccagtgatgcggtgaacctggaccgcatgtacgacctggtggcggtggtggttcactgt
ggcagtggtcctaaccgtgggcattatattactatcgtgaaaagtcacggcttctggctt
ttgtttgatgatgacattgtagagaaaatagatgcccaagctattgaagaattctatggc
ctgacatcagatatatcaaaaaattcagaatctggatatattttattctatcagtcaaga
gaataa

DBGET integrated database retrieval system