KEGG   Sus scrofa (pig): 100522203Help
Entry
100522203         CDS       T01009                                 

Gene name
PDIA4
Definition
protein disulfide isomerase family A, member 4 (EC:5.3.4.1)
Orthology
K09582  
protein disulfide-isomerase A4 [EC:5.3.4.1]
Organism
ssc  Sus scrofa (pig)
Pathway
Protein processing in endoplasmic reticulum
Thyroid hormone synthesis
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:ssc04141]
Organismal Systems; Endocrine system; Thyroid hormone synthesis [PATH:ssc04918]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
9
AA seq 646 aa AA seqDB search
MRPRKACLLLLLLALAQLLAAASAGGPDEDSSHKEDALEEEEEEEEDDDEEEDDDDLEVK
EENGVLVLKDSNFDNFVADKDTVLLEFYAPWCGHCKQFAPEYEKIATTLKENDPPIPVAK
IDATSESELASRFDVSGYPTIKILKKGQAVDYEGSRTQEEIVAKVKEISQPNWIPPPEVT
LVLTKDNFDEVVNDADIILVEFYAPWCGHCKKLAPEYERAAKELSKRSPPIPLAKVDATA
ETDLAKRFDVSGYPTLKIFRKGKPFDYNGPREKYGIVDYMIEQSGPPSKQILALKQVQEF
LKDGDDVIIIGVFNSESDPAYQQYQDAANSLREDYKLYHTFSTEIAKFLKVSPDKLVVMQ
PEKFQSKYEPQSHVLHIQGSTEASAIKEHVLKYTLPLVGHRKASNDAKRYSRRPLVVVYY
GVDFSFDYRAATQFWRSKVLEVAKDFPEYTFAVADEEDFATEVKDLGLSESGEEVNAAIL
DEGGRKFAMEPDDFDANALRSFVTAFKKGKLRPVIKSQPVPKNNKGPVKIVVGKTFDSIV
LDPKKDVLIEFYAPWCGHCKQLEPVYTSLGKKYKGHKNLVIAKMDATSNDITNDRYKVEG
FPTIYFAPSGDKKNPIKFEDGNRDLEHLSKFIEDHATKLSRTKEEL
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgaggccccggaaagcatgcctgctcctcctgctcctggccctggctcagctgctggcc
gcggcgagcgccgggggcccagacgaagattcttctcataaagaagatgctcttgaggag
gaggaggaggaggaagaggacgacgatgaggaggaggacgacgatgacttagaagttaag
gaagaaaacggagtcttagtcctaaaagactcgaactttgataacttcgtggctgacaaa
gacacggtgctactggagttctacgctccgtggtgcggacattgcaagcagtttgctcca
gaatatgaaaaaattgcaactaccttgaaggagaatgaccctcccattcctgtcgcaaag
atcgacgcgacctcagagtcggaactggccagcaggtttgatgtgagcggctaccccacc
atcaagatccttaaaaaggggcaggctgttgactacgagggctccaggacccaggaagaa
attgttgccaaggtcaaagagatctcccagcccaactggattcccccaccagaagtcact
ctcgtgctgaccaaagataacttcgatgaagtggtgaatgacgcagacatcattctggtg
gagttttatgccccatggtgtggacactgtaagaaactggcccctgagtacgagagggct
gccaaggagctgagcaagcgctcacccccgatccccctggcaaaggttgacgccaccgca
gaaactgacctggccaagaggtttgatgtttccggctatcccaccctgaaaatcttccgc
aaggggaagccctttgattacaacggcccacgggaaaaatacgggattgttgactacatg
attgagcagtcggggccaccctccaagcagatcctggccctgaagcaggtccaggagttc
ctgaaggatggggatgatgtcatcatcattggcgtcttcaactcggagagtgacccagcc
taccagcagtaccaggacgccgctaacagcctgagagaagattacaaattgtaccacact
ttcagcactgaaatagcaaagttcttgaaagtctccccagacaagttggtcgtcatgcaa
cctgagaaattccaatccaaatacgagcctcagagccacgtgctgcacatccagggctcc
acggaggcctctgccatcaaggagcacgtgctgaagtacaccctgcccctggtcggccac
cgcaaggcctccaatgacgccaagcgctactcgcggcgccccctggtggtcgtgtactac
ggcgtggacttcagcttcgactaccgggcagccactcagttctggcggagcaaggtcctg
gaggtggccaaggacttccccgagtacacctttgccgtggccgacgaagaggacttcgcc
acggaggtgaaggacctggggctcagtgagagcggcgaggaggtgaacgcagccatcctg
gacgagggcggccgcaagttcgccatggagcccgatgacttcgatgccaacgccctccgc
agctttgtcactgccttcaagaagggaaaactgaggcccgttatcaaatcccagccggtg
cccaagaacaacaaggggccagtcaagatcgtggtggggaagacctttgactccattgtg
ttggatcccaagaaggatgtcctcattgagttctacgcaccctggtgcgggcactgcaag
cagctggagcccgtgtacacctccctgggcaagaagtacaagggccacaagaatctagtc
attgccaagatggacgcaacatccaatgacatcaccaatgaccgctacaaagtcgagggg
ttccccaccatctactttgcccccagtggggataaaaagaacccaattaaatttgaggat
ggaaacagagatctggagcatttgagcaagtttatagaagatcatgccacaaaactgagc
agaaccaaggaagaactttga

DBGET integrated database retrieval system