KEGG   Sus scrofa (pig): 100522367Help
Entry
100522367         CDS       T01009                                 

Gene name
KAT8, MYST1, mof
Definition
K(lysine) acetyltransferase 8
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
ssc  Sus scrofa (pig)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Vega: 
UniProt: 
Position
3
AA seq 458 aa AA seqDB search
MAAQGAAAAVAAATSGVAGEGDPGPGENAAVEGTAPSPGRVSPPTPARGEPEVTVEIGET
YLCRRPDSTWHSAEVIQSRVNDQEGREEFYVHYVGFNRRLDEWVDKNRLALTKTVKDAVQ
KNSEKYLSELAEQPERKITRNQKRKHDEINHVQKTYAEMDPTTAALEKEHEAITKVKYVD
KIHIGNYEIDAWYFSPFPEDYGKQPKLWLCEYCLKYMKYEKSYRFHLGQCQWRQPPGKEI
YRKSNISVYEVDGKDHKIYCQNLCLLAKLFLDHKTLYFDVEPFVFYILTEVDRQGAHIVG
YFSKEKESPDGNNVACILTLPPYQRRGYGKFLIAFSYELSKLESTVGSPEKPLSDLGKLS
YRSYWSWVLLEILRDFRGTLSIKDLSQMTSITQNDIISTLQSLNMVKYWKGQHVICVTPK
LVEEHLKSAQYKKPPITVDSVCLKWAPPKHKQVKLSKK
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggcggcacagggagcagctgcagccgttgcggcggcgacttcaggggtcgcgggggag
ggcgaccccgggcctggggagaatgcggcggtcgaggggaccgccccgtccccaggccgc
gtctctccgccgaccccggcgcggggagagccggaagtcaccgtggaaattggagaaacg
tacctgtgccggcgaccggatagcacctggcattctgctgaagtgatccagtctcgagtg
aacgatcaggagggccgagaggaattctatgtacactatgtgggctttaaccggcgactg
gacgaatgggtagacaagaaccggctggcactgaccaagacagtgaaggatgccgtgcag
aagaactcggagaagtacctgagtgagctggctgagcagcccgagcgcaagatcactcgc
aaccaaaagcgcaagcacgatgagatcaaccacgtgcagaagacctatgctgagatggac
cccacgacagcagccttggagaaggaacacgaggcgatcaccaaggtgaagtacgtggac
aagatccacatcggcaactacgaaatcgatgcctggtacttctccccgttccccgaggac
tatgggaagcagccgaaactctggctctgcgagtactgtctcaagtacatgaaatatgag
aagagctaccgcttccacttgggccagtgccagtggcggcagcccccggggaaggagatc
taccgcaagagcaacatctctgtgtacgaggtggacggcaaagaccacaagatttactgt
cagaacctgtgtctgctggccaagcttttcctggaccacaagacgctgtactttgacgtg
gagccgttcgtcttctacatcttgaccgaggtggacaggcagggggctcacatcgtcggc
tacttctccaaggagaaggagtcgccagacgggaacaacgtggcctgcatcctgaccctg
cccccctaccagcgccgaggctatgggaagttcctcatcgcgttcagttatgagctgtcc
aagctggagagcacggtaggctcccctgagaagccgctgtctgacctgggcaagctcagc
taccgcagctactggtcctgggtcctgctggagatcctgcgagacttcaggggcacactg
tccatcaaggaccttagccagatgacgagtatcacccagaatgacatcatcagcaccctc
cagtccctcaacatggtcaagtactggaagggccagcacgtgatctgcgtcacacccaag
ctggtggaggagcatctcaagagtgcccagtataagaaaccgcccataacggtggactct
gtctgcctcaagtgggcgccccccaagcacaagcaagtcaaactctccaagaagtga

DBGET integrated database retrieval system