KEGG   Sus scrofa (pig): 100522544Help
Entry
100522544         CDS       T01009                                 

Gene name
BCKDK
Definition
branched chain ketoacid dehydrogenase kinase
Orthology
K00905  
[3-methyl-2-oxobutanoate dehydrogenase (acetyl-transferring)] kinase [EC:2.7.11.4]
Organism
ssc  Sus scrofa (pig)
Brite
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.4  [3-methyl-2-oxobutanoate dehydrogenase (acetyl-transferring)] kinase
     100522544 (BCKDK)
Protein kinases [BR:ssc01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   100522544 (BCKDK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
3
AA seq 412 aa AA seqDB search
MMLASVLGSGPRGGPPLRPLLGPALSLRALSTSATDTHHVEMARERSKTVTSFYNQSAID
AAAEKPSVRLTPTMMLYSGRSQDGSHLLKSARYLQQELPVRIAHRIKDFRSLPFIIGCNP
TILHVHELYIRAFQKLTDFPPIKDQADEAQYCQLVRQLLDDHKDVVTLLAEGLRESRKHI
EDEKLVRSFLDKTLTSRLGIRMLATHHLALHEDKPDFVGIICTRLSPKKIIEKWVDFARR
LCEHKYGNAPRVRINGHVAARFPFIPMPLDYILPELLKNAMRATMECHLDTPYNVPDVVI
TIANNDIDLVIRISDRGGGIAHKDLDRVMDYHFTTAEASTQDPRISPLFGHLDMHSGSQS
GPMHGFGFGLPTSRAYAEYLGGSLRLQSLQGIGTDVYLRLRHIDGREESFRI
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgatgctggcatcggtgctggggagtggtccccggggggggccaccactccggcctctc
ttggggcccgcactctcgctccgggccctctccacatcagccaccgatacccaccacgtg
gagatggcgcgggagcgctccaagaccgtcacctccttttacaaccagtcagccatcgac
gcagcagcagagaagccctcagtccgcctcactccgaccatgatgctctattcaggacgc
tctcaggatggcagccacctgctgaaaagtgctcggtacttgcagcaagagttgcccgtg
aggattgctcaccgcatcaaggacttccgcagccttcctttcatcattggctgcaacccc
actatactgcacgtgcacgaactgtacatccgtgccttccagaagctgacagacttccct
ccgatcaaggaccaggcggatgaggcccagtactgccagctggtgcgacagctgttggac
gaccacaaggatgtggtgaccctcttggctgagggcctgcgtgagagccggaagcacata
gaggacgagaagctggtccgctccttcttagacaagacgctgacttcgaggctcgggatc
cgcatgttggccacacaccatctggctctacatgaggacaagcccgactttgttggcatc
atctgcactcgcctctcaccaaagaagattattgaaaaatgggtggactttgccagacgc
ctgtgtgagcacaagtatggcaacgccccccgggtccgcatcaacggccacgtggctgcc
cgtttccccttcatccccatgccgctggactacatcctgcccgagctgctcaagaatgcc
atgagagccacgatggaatgtcacctagacacgccctacaacgtcccggatgtggtcatc
accatcgccaacaacgatattgatctcgtcatcaggatttctgaccggggtgggggaatt
gctcacaaagacctggatcgggttatggactaccacttcaccacggccgaggccagtacc
caggacccccggatcagccctctcttcggccacctagacatgcacagtggcagccagtcg
ggacccatgcacggctttggcttcgggctgcccacgtcgcgggcttatgcagaatacctc
ggtggttcccttcggctgcagtccctgcagggcatcggcacggatgtctacctgcggctt
cggcacatcgatggccgggaggaaagcttccgcatctga

DBGET integrated database retrieval system