KEGG   Sus scrofa (pig): 100522613Help
Entry
100522613         CDS       T01009                                 

Gene name
ADCY6
Definition
(RefSeq) LOW QUALITY PROTEIN: adenylate cyclase type 6
  KO
K08046  
adenylate cyclase 6 [EC:4.6.1.1]
Organism
ssc  Sus scrofa (pig)
Pathway
Purine metabolism
Endocrine resistance
Rap1 signaling pathway
cGMP-PKG signaling pathway
cAMP signaling pathway
Chemokine signaling pathway
Phospholipase D signaling pathway
Oocyte meiosis
Longevity regulating pathway
Longevity regulating pathway - multiple species
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Apelin signaling pathway
Gap junction
Platelet activation
Circadian entrainment
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
GABAergic synapse
Taste transduction
Inflammatory mediator regulation of TRP channels
Insulin secretion
GnRH signaling pathway
Ovarian steroidogenesis
Progesterone-mediated oocyte maturation
Estrogen signaling pathway
Melanogenesis
Thyroid hormone synthesis
Oxytocin signaling pathway
Regulation of lipolysis in adipocytes
Renin secretion
Aldosterone synthesis and secretion
Endocrine and other factor-regulated calcium reabsorption
Vasopressin-regulated water reabsorption
Salivary secretion
Gastric acid secretion
Pancreatic secretion
Bile secretion
Morphine addiction
HTLV-I infection
Pathways in cancer
Dilated cardiomyopathy (DCM)
Module
cAMP signaling
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    100522613 (ADCY6)
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    100522613 (ADCY6)
   04371 Apelin signaling pathway
    100522613 (ADCY6)
   04072 Phospholipase D signaling pathway
    100522613 (ADCY6)
   04024 cAMP signaling pathway
    100522613 (ADCY6)
   04022 cGMP - PKG signaling pathway
    100522613 (ADCY6)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    100522613 (ADCY6)
  Cellular community - eukaryotes
   04540 Gap junction
    100522613 (ADCY6)
 Organismal Systems
  Immune system
   04611 Platelet activation
    100522613 (ADCY6)
   04062 Chemokine signaling pathway
    100522613 (ADCY6)
  Endocrine system
   04911 Insulin secretion
    100522613 (ADCY6)
   04923 Regulation of lipolysis in adipocyte
    100522613 (ADCY6)
   04912 GnRH signaling pathway
    100522613 (ADCY6)
   04913 Ovarian Steroidogenesis
    100522613 (ADCY6)
   04915 Estrogen signaling pathway
    100522613 (ADCY6)
   04914 Progesterone-mediated oocyte maturation
    100522613 (ADCY6)
   04921 Oxytocin signaling pathway
    100522613 (ADCY6)
   04918 Thyroid hormone synthesis
    100522613 (ADCY6)
   04916 Melanogenesis
    100522613 (ADCY6)
   04924 Renin secretion
    100522613 (ADCY6)
   04925 Aldosterone synthesis and secretion
    100522613 (ADCY6)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100522613 (ADCY6)
   04270 Vascular smooth muscle contraction
    100522613 (ADCY6)
  Digestive system
   04970 Salivary secretion
    100522613 (ADCY6)
   04971 Gastric acid secretion
    100522613 (ADCY6)
   04972 Pancreatic secretion
    100522613 (ADCY6)
   04976 Bile secretion
    100522613 (ADCY6)
  Excretory system
   04962 Vasopressin-regulated water reabsorption
    100522613 (ADCY6)
   04961 Endocrine and other factor-regulated calcium reabsorption
    100522613 (ADCY6)
  Nervous system
   04724 Glutamatergic synapse
    100522613 (ADCY6)
   04727 GABAergic synapse
    100522613 (ADCY6)
   04725 Cholinergic synapse
    100522613 (ADCY6)
   04723 Retrograde endocannabinoid signaling
    100522613 (ADCY6)
  Sensory system
   04742 Taste transduction
    100522613 (ADCY6)
   04750 Inflammatory mediator regulation of TRP channels
    100522613 (ADCY6)
  Aging
   04211 Longevity regulating pathway - mammal
    100522613 (ADCY6)
   04213 Longevity regulating pathway - multiple species
    100522613 (ADCY6)
  Environmental adaptation
   04713 Circadian entrainment
    100522613 (ADCY6)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100522613 (ADCY6)
  Substance dependence
   05032 Morphine addiction
    100522613 (ADCY6)
  Cardiovascular diseases
   05414 Dilated cardiomyopathy (DCM)
    100522613 (ADCY6)
  Infectious diseases
   05166 HTLV-I infection
    100522613 (ADCY6)
  Drug resistance
   01522 Endocrine resistance
    100522613 (ADCY6)
Enzymes [BR:ssc01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100522613 (ADCY6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
5
AA seq 1166 aa AA seqDB search
MSWFSGLLVPKVDERKTAWGERNGQKRPRRGTRTSGFCTPRYMSCLQEAQPPSPTPAAAP
RCPWQEEAFIRRGGPGKGVELGLRXVALGFEDPEATVAGGAAEVAPDVAPRSGRACWRRL
VQVFQSKQFRSAKLERLYQRYFFQMNQSSLTLLMAVLLLLTAVLLAFHAAPARPQPAYVA
LLACAAALFVALMVVCNRHSFRQDSMWVVSYVVLGILAAVQVGGALAAHPHSPSAGLWCP
VFFVYITYTLLPIRMRAAVFSGLGLSTLHLILAWQLNRGDAFLWKQLGANMLLFLCTNVI
GICTHYPAEVSQRQAFQETRGYIQARLHLQHENRQQERLLLSVLPQHVAMEMKEDINTKK
EDMMFHKIXIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAENHCLR
IKILGDCYYCVSGLPEARADHAHCCVEMGVDMIEAISLVREVTGVNVNMRVGIHSGRVHC
GVLGLRKWQFDVWSNDVTLANHMEAGGRAGRIHITRATLQYLNGDYEVEPGRGGERNAYL
KEQHIETFLILGASQKRKEEKAVLAKLQRTRANSMEGLMPRWVPDRTFSRTKDSKAFRQM
GIDDSSKDNRGAQDALNPEDEVDEFLGRAIDARSIDQLRKDHVRRFLLTFQREDLEKKYS
RKVDPRFGAYVACALLVFCFICFIQLLVFPHSALVLGIYAGIFLLLLVTVLACAVYSCGS
LFPEALRRLSRSIVRSRAHSTAVGIFSVLLVFTSAIANMFTCNHTPIRTCAARMLNLTPA
DVTPCHLQQLNYSLGLDAPLCEGTAPTCSFPEYFVGNALLSLLASSVFLHISSIGKLAMI
LVLGLIYLVLLLLGPPATIFDNYDLLLGVHGLASSNETFDGLHCPAAGRVALKYMTPVIL
LVFALALYLHAQQVESTARLDFLWKLQATGEKEEMEELQAYNRRLLHNILPKDVAAHFLA
RERRNDELYYQSCECVAVMFASIANFSEFYVELEANNEGVECLRLLNEIIADFDEIISEE
RFRQLEKIKTIGSTYMAASGLNASTYDQVGRSHITALADYAMRLMEQMKHINEHSFNNFQ
MKIGLNMGPVVAGVIGARKPQYDIWGNTVNVSSRMDSTGVPDRIQVTTDLYQVLAAKGYQ
LECRGVVKVKGKGEMTTYFLNGGPSS
NT seq 3501 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtggtttagtggcctcctggtccccaaagtggatgaacggaaaacagcctggggc
gagcgcaatgggcagaagcgtccgcgccgggggactcgcaccagtggcttctgcacaccc
cgttatatgagctgcctccaggaggcacagccgcccagcccgacccctgccgctgcccct
cggtgcccctggcaggaggaggccttcatccggaggggcggcccaggcaagggcgtggag
ctggggctgcggngcgtggccctgggcttcgaggacccggaggcgaccgtggccggcggg
gcggccgaggtggcccctgatgtggcccccaggagcgggcgagcctgctggcgccggctg
gtgcaggtgttccagtcgaagcagttccgctcggctaagctggagcgcctgtaccagcgg
tacttctttcagatgaaccagagcagcctgacgctgctgatggcggtgctgctgctgctc
acggcggtgctgctggccttccacgctgcgcccgcccgcccccagcctgcctacgtggcc
ctgctggcctgcgccgccgccctcttcgtggcgctcatggtcgtgtgcaaccgacacagc
ttccgccaggactccatgtgggtggtgagctacgtggtgctgggcatcctggcggctgtg
caggtcgggggcgccctggcggcgcacccccacagcccttccgctggcctctggtgcccc
gtcttctttgtctacatcacctacacgctcctccccatccgcatgcgggcagccgtcttc
agcggcctgggcctctccaccctgcacttgatcttggcctggcaactcaaccgtggtgat
gccttcctctggaagcagctcggtgccaacatgctgctgttcctctgcaccaatgtcatc
ggcatctgcacacactacccggctgaggtgtcgcagcgccaggcctttcaggagacccgt
ggttacatccaggcccggctgcacctgcaacacgagaatcggcagcaggagcggctgctg
ctgtccgtgttgccccagcatgttgccatggagatgaaagaagacatcaacacaaagaaa
gaagacatgatgtttcacaagatcntaatccagaagcatgacaacgtcagcatcctgttt
gccgacattgaaggcttcaccagtctggcatcccagtgcaccgcacaggagctggtcatg
accctgaacgagctctttgcccggtttgacaagttggctgcggaaaatcactgcctgagg
atcaagatcttaggggactgttactactgtgtgtcagggctgcccgaggcccgtgcagac
cacgcccactgctgcgtggagatgggcgtggacatgatcgaggccatctcgctggtgcgc
gaggtgacgggcgtgaacgtgaacatgcgcgtgggcatccatagcgggcgtgtgcactgc
ggcgtcctcggcctgcggaagtggcagttcgacgtgtggtccaatgatgtgactctggcc
aaccacatggaggcggggggccgggccggccgcatccacatcactcgggccacgctgcag
tacctgaacggcgactacgaggtggagccgggccggggcggggagcgcaacgcctacctc
aaggagcagcacatcgagaccttcctgatcctgggcgccagccagaaacggaaggaggag
aaggccgtgctggccaagctgcagcggaccagggccaactccatggaagggctgatgcca
cgctgggtgcccgaccgcaccttctcccggaccaaggactccaaggctttccgccagatg
ggcattgatgactccagcaaagacaaccgaggtgcccaggacgccctcaaccctgaggat
gaggtggacgagttcctgggccgagccatcgatgcccgcagcatcgatcagctgcgcaag
gaccatgtgcgccggttcctgctcaccttccagagggaggatcttgaaaagaagtactcg
cggaaggtggacccccgcttcggcgcctacgtggcctgtgccctgttggtcttctgcttc
atctgcttcatccagctcctcgtcttcccacactcagccctggtgcttgggatctatgcc
gggatcttcctcctgctgctggtcaccgtgttggcctgtgccgtgtactcctgtggctct
ctgttccctgaggccctgcggcgtctgtcgcgcagcatcgtccgctctcgggcacacagc
actgcggttggcatcttttcggtcctgcttgtgttcacttccgccattgccaacatgttc
acctgtaaccacacccccatacggacttgcgcagcccggatgctgaatctgacacctgct
gacgtcaccccctgccacctacagcagctcaattactctctgggcctggatgctcccctg
tgtgagggcaccgcacccacctgcagcttccctgagtacttcgtcgggaacgcgctgctg
agtctcttggccagctctgtcttcctgcacatcagtagcatcgggaagctggccatgatc
cttgtcctcgggctcatctatttggtgctgctcctgctgggtcccccggccaccatcttt
gacaactacgacctactgcttggcgtccatggcttggcttcgtccaacgagaccttcgat
gggctgcactgcccagctgcaggcagggtggcactcaaatacatgaccccggtgattctg
ctggtctttgcactggcgctctatctgcatgcccagcaggtggaatcgactgcccgcctg
gacttcctctggaaactgcaggcaacaggggagaaggaggagatggaggagctgcaggca
tacaaccggcggctgctccataacattctgcccaaggatgtagcggcccacttcctggcc
cgggagcgccggaacgacgagctctactatcagtcgtgcgagtgtgtggccgtcatgttc
gcctccattgccaacttctccgagttttacgtggagctggaggcaaacaacgagggtgtc
gagtgcctgcggctgctcaacgagatcatcgcggactttgacgagatcatcagcgaggag
cgcttccggcagctggagaagatcaagaccattgggagcacgtacatggctgcctccggg
ctgaacgccagcacctacgatcaggtgggccgctcccacatcaccgccctggccgactac
gccatgcggctcatggagcagatgaagcacatcaacgagcactccttcaacaatttccag
atgaagatcgggctgaacatgggtccggtggtggcaggcgtcatcggggcccggaagccg
cagtatgacatctgggggaacacagtgaatgtctctagccgtatggacagcaccggggtc
cctgaccgaatccaggtgaccacggacctgtaccaggttctagcggccaagggctaccag
ctggagtgtcgcggggtggtcaaggtgaagggcaagggggaaatgaccacctacttcctc
aatgggggccccagcagttag

DBGET integrated database retrieval system