KEGG   Sus scrofa (pig): 100522613Help
Entry
100522613         CDS       T01009                                 

Gene name
ADCY6
Definition
(RefSeq) LOW QUALITY PROTEIN: adenylate cyclase type 6
  KO
K08046  adenylate cyclase 6 [EC:4.6.1.1]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00230  Purine metabolism
ssc01522  Endocrine resistance
ssc04015  Rap1 signaling pathway
ssc04022  cGMP-PKG signaling pathway
ssc04024  cAMP signaling pathway
ssc04062  Chemokine signaling pathway
ssc04072  Phospholipase D signaling pathway
ssc04114  Oocyte meiosis
ssc04211  Longevity regulating pathway
ssc04213  Longevity regulating pathway - multiple species
ssc04261  Adrenergic signaling in cardiomyocytes
ssc04270  Vascular smooth muscle contraction
ssc04371  Apelin signaling pathway
ssc04540  Gap junction
ssc04611  Platelet activation
ssc04713  Circadian entrainment
ssc04714  Thermogenesis
ssc04723  Retrograde endocannabinoid signaling
ssc04724  Glutamatergic synapse
ssc04725  Cholinergic synapse
ssc04727  GABAergic synapse
ssc04742  Taste transduction
ssc04750  Inflammatory mediator regulation of TRP channels
ssc04911  Insulin secretion
ssc04912  GnRH signaling pathway
ssc04913  Ovarian steroidogenesis
ssc04914  Progesterone-mediated oocyte maturation
ssc04915  Estrogen signaling pathway
ssc04916  Melanogenesis
ssc04918  Thyroid hormone synthesis
ssc04921  Oxytocin signaling pathway
ssc04923  Regulation of lipolysis in adipocytes
ssc04924  Renin secretion
ssc04925  Aldosterone synthesis and secretion
ssc04926  Relaxin signaling pathway
ssc04927  Cortisol synthesis and secretion
ssc04928  Parathyroid hormone synthesis, secretion and action
ssc04934  Cushing's syndrome
ssc04961  Endocrine and other factor-regulated calcium reabsorption
ssc04962  Vasopressin-regulated water reabsorption
ssc04970  Salivary secretion
ssc04971  Gastric acid secretion
ssc04972  Pancreatic secretion
ssc04976  Bile secretion
ssc05032  Morphine addiction
ssc05166  HTLV-I infection
ssc05200  Pathways in cancer
ssc05414  Dilated cardiomyopathy (DCM)
Module
ssc_M00695  cAMP signaling
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    100522613 (ADCY6)
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    100522613 (ADCY6)
   04371 Apelin signaling pathway
    100522613 (ADCY6)
   04072 Phospholipase D signaling pathway
    100522613 (ADCY6)
   04024 cAMP signaling pathway
    100522613 (ADCY6)
   04022 cGMP - PKG signaling pathway
    100522613 (ADCY6)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    100522613 (ADCY6)
  Cellular community - eukaryotes
   04540 Gap junction
    100522613 (ADCY6)
 Organismal Systems
  Immune system
   04611 Platelet activation
    100522613 (ADCY6)
   04062 Chemokine signaling pathway
    100522613 (ADCY6)
  Endocrine system
   04911 Insulin secretion
    100522613 (ADCY6)
   04923 Regulation of lipolysis in adipocyte
    100522613 (ADCY6)
   04912 GnRH signaling pathway
    100522613 (ADCY6)
   04913 Ovarian Steroidogenesis
    100522613 (ADCY6)
   04915 Estrogen signaling pathway
    100522613 (ADCY6)
   04914 Progesterone-mediated oocyte maturation
    100522613 (ADCY6)
   04921 Oxytocin signaling pathway
    100522613 (ADCY6)
   04926 Relaxin signaling pathway
    100522613 (ADCY6)
   04918 Thyroid hormone synthesis
    100522613 (ADCY6)
   04928 Parathyroid hormone synthesis, secretion and action
    100522613 (ADCY6)
   04916 Melanogenesis
    100522613 (ADCY6)
   04924 Renin secretion
    100522613 (ADCY6)
   04925 Aldosterone synthesis and secretion
    100522613 (ADCY6)
   04927 Cortisol synthesis and secretion
    100522613 (ADCY6)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100522613 (ADCY6)
   04270 Vascular smooth muscle contraction
    100522613 (ADCY6)
  Digestive system
   04970 Salivary secretion
    100522613 (ADCY6)
   04971 Gastric acid secretion
    100522613 (ADCY6)
   04972 Pancreatic secretion
    100522613 (ADCY6)
   04976 Bile secretion
    100522613 (ADCY6)
  Excretory system
   04962 Vasopressin-regulated water reabsorption
    100522613 (ADCY6)
   04961 Endocrine and other factor-regulated calcium reabsorption
    100522613 (ADCY6)
  Nervous system
   04724 Glutamatergic synapse
    100522613 (ADCY6)
   04727 GABAergic synapse
    100522613 (ADCY6)
   04725 Cholinergic synapse
    100522613 (ADCY6)
   04723 Retrograde endocannabinoid signaling
    100522613 (ADCY6)
  Sensory system
   04742 Taste transduction
    100522613 (ADCY6)
   04750 Inflammatory mediator regulation of TRP channels
    100522613 (ADCY6)
  Aging
   04211 Longevity regulating pathway - mammal
    100522613 (ADCY6)
   04213 Longevity regulating pathway - multiple species
    100522613 (ADCY6)
  Environmental adaptation
   04713 Circadian entrainment
    100522613 (ADCY6)
   04714 Thermogenesis
    100522613 (ADCY6)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100522613 (ADCY6)
  Substance dependence
   05032 Morphine addiction
    100522613 (ADCY6)
  Cardiovascular diseases
   05414 Dilated cardiomyopathy (DCM)
    100522613 (ADCY6)
  Endocrine and metabolic diseases
   04934 Cushing's syndrome
    100522613 (ADCY6)
  Infectious diseases
   05166 HTLV-I infection
    100522613 (ADCY6)
  Drug resistance
   01522 Endocrine resistance
    100522613 (ADCY6)
Enzymes [BR:ssc01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100522613 (ADCY6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AC_N Guanylate_cyc DUF1053 HNOBA
Motif
Other DBs
NCBI-GeneID: 100522613
NCBI-ProteinID: XP_020947245
Ensembl: ENSSSCG00000000175
Position
5
AA seq 1166 aa AA seqDB search
MSWFSGLLVPKVDERKTAWGERNGQKRPRRGTRTSGFCTPRYMSCLQEAQPPSPTPAAAP
RCPWQEEAFIRRGGPGKGVELGLRXVALGFEDPEATVAGGAAEVAPDVAPRSGRACWRRL
VQVFQSKQFRSAKLERLYQRYFFQMNQSSLTLLMAVLLLLTAVLLAFHAAPARPQPAYVA
LLACAAALFVALMVVCNRHSFRQDSMWVVSYVVLGILAAVQVGGALAAHPHSPSAGLWCP
VFFVYITYTLLPIRMRAAVFSGLGLSTLHLILAWQLNRGDAFLWKQLGANMLLFLCTNVI
GICTHYPAEVSQRQAFQETRGYIQARLHLQHENRQQERLLLSVLPQHVAMEMKEDINTKK
EDMMFHKIXIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAENHCLR
IKILGDCYYCVSGLPEARADHAHCCVEMGVDMIEAISLVREVTGVNVNMRVGIHSGRVHC
GVLGLRKWQFDVWSNDVTLANHMEAGGRAGRIHITRATLQYLNGDYEVEPGRGGERNAYL
KEQHIETFLILGASQKRKEEKAVLAKLQRTRANSMEGLMPRWVPDRTFSRTKDSKAFRQM
GIDDSSKDNRGAQDALNPEDEVDEFLGRAIDARSIDQLRKDHVRRFLLTFQREDLEKKYS
RKVDPRFGAYVACALLVFCFICFIQLLVFPHSALVLGIYAGIFLLLLVTVLACAVYSCGS
LFPEALRRLSRSIVRSRAHSTAVGIFSVLLVFTSAIANMFTCNHTPIRTCAARMLNLTPA
DVTPCHLQQLNYSLGLDAPLCEGTAPTCSFPEYFVGNALLSLLASSVFLHISSIGKLAMI
LVLGLIYLVLLLLGPPATIFDNYDLLLGVHGLASSNETFDGLHCPAAGRVALKYMTPVIL
LVFALALYLHAQQVESTARLDFLWKLQATGEKEEMEELQAYNRRLLHNILPKDVAAHFLA
RERRNDELYYQSCECVAVMFASIANFSEFYVELEANNEGVECLRLLNEIIADFDEIISEE
RFRQLEKIKTIGSTYMAASGLNASTYDQVGRSHITALADYAMRLMEQMKHINEHSFNNFQ
MKIGLNMGPVVAGVIGARKPQYDIWGNTVNVSSRMDSTGVPDRIQVTTDLYQVLAAKGYQ
LECRGVVKVKGKGEMTTYFLNGGPSS
NT seq 3501 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtggtttagtggcctcctggtccccaaagtggatgaacggaaaacagcctggggc
gagcgcaatgggcagaagcgtccgcgccgggggactcgcaccagtggcttctgcacaccc
cgttatatgagctgcctccaggaggcacagccgcccagcccgacccctgccgctgcccct
cggtgcccctggcaggaggaggccttcatccggaggggcggcccaggcaagggcgtggag
ctggggctgcggngcgtggccctgggcttcgaggacccggaggcgaccgtggccggcggg
gcggccgaggtggcccctgatgtggcccccaggagcgggcgagcctgctggcgccggctg
gtgcaggtgttccagtcgaagcagttccgctcggctaagctggagcgcctgtaccagcgg
tacttctttcagatgaaccagagcagcctgacgctgctgatggcggtgctgctgctgctc
acggcggtgctgctggccttccacgctgcgcccgcccgcccccagcctgcctacgtggcc
ctgctggcctgcgccgccgccctcttcgtggcgctcatggtcgtgtgcaaccgacacagc
ttccgccaggactccatgtgggtggtgagctacgtggtgctgggcatcctggcggctgtg
caggtcgggggcgccctggcggcgcacccccacagcccttccgctggcctctggtgcccc
gtcttctttgtctacatcacctacacgctcctccccatccgcatgcgggcagccgtcttc
agcggcctgggcctctccaccctgcacttgatcttggcctggcaactcaaccgtggtgat
gccttcctctggaagcagctcggtgccaacatgctgctgttcctctgcaccaatgtcatc
ggcatctgcacacactacccggctgaggtgtcgcagcgccaggcctttcaggagacccgt
ggttacatccaggcccggctgcacctgcaacacgagaatcggcagcaggagcggctgctg
ctgtccgtgttgccccagcatgttgccatggagatgaaagaagacatcaacacaaagaaa
gaagacatgatgtttcacaagatcntaatccagaagcatgacaacgtcagcatcctgttt
gccgacattgaaggcttcaccagtctggcatcccagtgcaccgcacaggagctggtcatg
accctgaacgagctctttgcccggtttgacaagttggctgcggaaaatcactgcctgagg
atcaagatcttaggggactgttactactgtgtgtcagggctgcccgaggcccgtgcagac
cacgcccactgctgcgtggagatgggcgtggacatgatcgaggccatctcgctggtgcgc
gaggtgacgggcgtgaacgtgaacatgcgcgtgggcatccatagcgggcgtgtgcactgc
ggcgtcctcggcctgcggaagtggcagttcgacgtgtggtccaatgatgtgactctggcc
aaccacatggaggcggggggccgggccggccgcatccacatcactcgggccacgctgcag
tacctgaacggcgactacgaggtggagccgggccggggcggggagcgcaacgcctacctc
aaggagcagcacatcgagaccttcctgatcctgggcgccagccagaaacggaaggaggag
aaggccgtgctggccaagctgcagcggaccagggccaactccatggaagggctgatgcca
cgctgggtgcccgaccgcaccttctcccggaccaaggactccaaggctttccgccagatg
ggcattgatgactccagcaaagacaaccgaggtgcccaggacgccctcaaccctgaggat
gaggtggacgagttcctgggccgagccatcgatgcccgcagcatcgatcagctgcgcaag
gaccatgtgcgccggttcctgctcaccttccagagggaggatcttgaaaagaagtactcg
cggaaggtggacccccgcttcggcgcctacgtggcctgtgccctgttggtcttctgcttc
atctgcttcatccagctcctcgtcttcccacactcagccctggtgcttgggatctatgcc
gggatcttcctcctgctgctggtcaccgtgttggcctgtgccgtgtactcctgtggctct
ctgttccctgaggccctgcggcgtctgtcgcgcagcatcgtccgctctcgggcacacagc
actgcggttggcatcttttcggtcctgcttgtgttcacttccgccattgccaacatgttc
acctgtaaccacacccccatacggacttgcgcagcccggatgctgaatctgacacctgct
gacgtcaccccctgccacctacagcagctcaattactctctgggcctggatgctcccctg
tgtgagggcaccgcacccacctgcagcttccctgagtacttcgtcgggaacgcgctgctg
agtctcttggccagctctgtcttcctgcacatcagtagcatcgggaagctggccatgatc
cttgtcctcgggctcatctatttggtgctgctcctgctgggtcccccggccaccatcttt
gacaactacgacctactgcttggcgtccatggcttggcttcgtccaacgagaccttcgat
gggctgcactgcccagctgcaggcagggtggcactcaaatacatgaccccggtgattctg
ctggtctttgcactggcgctctatctgcatgcccagcaggtggaatcgactgcccgcctg
gacttcctctggaaactgcaggcaacaggggagaaggaggagatggaggagctgcaggca
tacaaccggcggctgctccataacattctgcccaaggatgtagcggcccacttcctggcc
cgggagcgccggaacgacgagctctactatcagtcgtgcgagtgtgtggccgtcatgttc
gcctccattgccaacttctccgagttttacgtggagctggaggcaaacaacgagggtgtc
gagtgcctgcggctgctcaacgagatcatcgcggactttgacgagatcatcagcgaggag
cgcttccggcagctggagaagatcaagaccattgggagcacgtacatggctgcctccggg
ctgaacgccagcacctacgatcaggtgggccgctcccacatcaccgccctggccgactac
gccatgcggctcatggagcagatgaagcacatcaacgagcactccttcaacaatttccag
atgaagatcgggctgaacatgggtccggtggtggcaggcgtcatcggggcccggaagccg
cagtatgacatctgggggaacacagtgaatgtctctagccgtatggacagcaccggggtc
cctgaccgaatccaggtgaccacggacctgtaccaggttctagcggccaagggctaccag
ctggagtgtcgcggggtggtcaaggtgaagggcaagggggaaatgaccacctacttcctc
aatgggggccccagcagttag

DBGET integrated database retrieval system