KEGG   Sus scrofa (pig): 100522692Help
Entry
100522692         CDS       T01009                                 

Gene name
BDH2
Definition
(RefSeq) 3-hydroxybutyrate dehydrogenase type 2
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00072  Synthesis and degradation of ketone bodies
ssc00650  Butanoate metabolism
ssc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    100522692 (BDH2)
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    100522692 (BDH2)
Enzymes [BR:ssc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     100522692 (BDH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short KR DUF1776 ADH_zinc_N AlaDh_PNT_C UDPG_MGDP_dh_N 3HCDH_N NAD_binding_10 Sacchrp_dh_NADP
Motif
Other DBs
NCBI-GeneID: 100522692
NCBI-ProteinID: XP_003129333
Ensembl: ENSSSCG00000009163 ENSSSCG00000022282
UniProt: I3LHC8
Position
8
AA seq 245 aa AA seqDB search
MGRLDGKVIILTAAAQGIGRAAALAFAREGAKVIATDINESKLQELENYPGIQTRVLDVT
KKKQIDEFANDIERLDVLFNVAGFVHHGTILDCEEKDWDFSMNLNVRSMYLMIKAFLPKM
LAQKSGNIINMSSVASSIKGVVNRCVYSATKAAVIGLTKSVAADFIQQGIRCNCVCPGTV
DTPSLQERIQARPNPEEALSDFLKRQKTGRFATAEEVALLCVYLASDESAYVTGNPVVID
GGWSL
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgggtcgacttgatgggaaggtcatcatcctgacagccgctgctcaggggatcggccgg
gcagctgccttggcttttgcaagagaaggtgccaaagtcatagccacagatatcaatgag
tccaaacttcaggaactggaaaactacccaggtattcaaactcgggtccttgatgtcaca
aagaagaaacaaattgatgagttcgccaatgacattgagaggcttgatgttctctttaat
gttgctggtttcgtccatcacggaaccatcctggactgtgaggagaaagactgggacttc
tcaatgaatctcaacgtccgcagcatgtacctgatgatcaaggcatttcttcctaaaatg
cttgctcagaaatctggcaacattatcaacatgtcctctgtggcttccagcatcaaagga
gttgtgaacaggtgtgtgtacagtgcaaccaaggcagctgtaattggcctcacaaagtcc
gtggctgcagacttcatccagcaaggcattcggtgcaactgtgtgtgtccaggtaccgtt
gataccccctctctgcaagaaagaatacaagctagaccaaatcctgaagaggcactgagc
gattttctaaagagacagaaaacaggaagatttgcaaccgcagaagaagtagccctgctc
tgcgtgtacttggcctctgatgaatctgcctacgtaacaggtaatcctgttgtcattgat
ggaggctggagcttgtga

DBGET integrated database retrieval system