KEGG   Sus scrofa (pig): 100522692Help
Entry
100522692         CDS       T01009                                 

Definition
3-hydroxybutyrate dehydrogenase type 2-like
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
ssc  Sus scrofa (pig)
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    100522692
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    100522692
Enzymes [BR:ssc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     100522692
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 245 aa AA seqDB search
MGRLDGKVIILTAAAQGIGRAAALAFAREGAKVIATDINESKLQELENYPGIQTRVLDVT
KKKQIDEFANDIERLDVLFNVAGFVHHGTILDCEEKDWDFSMNLNVRSMYLMIKAFLPKM
LAQKSGNIINMSSVASSIKGVVNRCVYSATKAAVIGLTKSVAADFIQQGIRCNCVCPGTV
DTPSLQERIQARPNPEEALSDFLKRQKTGRFATAEEVALLCVYLASDESAYVTGNPVVID
GGWSL
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgggtcgacttgatgggaaggtcatcatcctgacagccgctgctcaggggatcggccgg
gcagctgccttggcttttgcaagagaaggtgccaaagtcatagccacagatatcaatgag
tccaaacttcaggaactggaaaactacccaggtattcaaactcgggtccttgatgtcaca
aagaagaaacaaattgatgagttcgccaatgacattgagaggcttgatgttctctttaat
gttgctggtttcgtccatcacggaaccatcctggactgtgaggagaaagactgggacttc
tcaatgaatctcaacgtccgcagcatgtacctgatgatcaaggcatttcttcctaaaatg
cttgctcagaaatctggcaacattatcaacatgtcctctgtggcttccagcatcaaagga
gttgtgaacaggtgtgtgtacagtgcaaccaaggcagctgtaattggcctcacaaagtcc
gtggctgcagacttcatccagcaaggcattcggtgcaactgtgtgtgtccaggtaccgtt
gataccccctctctgcaagaaagaatacaagctagaccaaatcctgaagaggcactgagc
gattttctaaagagacagaaaacaggaagatttgcaaccgcagaagaagtagccctgctc
tgcgtgtacttggcctctgatgaatctgcctacgtaacaggtaatcctgttgtcattgat
ggaggctggagcttgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system