KEGG   Sus scrofa (pig): 100523071Help
Entry
100523071         CDS       T01009                                 

Gene name
USP1
Definition
ubiquitin specific peptidase 1
Orthology
K11832  
ubiquitin carboxyl-terminal hydrolase 1 [EC:3.4.19.12]
Organism
ssc  Sus scrofa (pig)
Pathway
Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Genetic Information Processing
  Replication and repair
   03460 Fanconi anemia pathway
    100523071 (USP1)
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100523071 (USP1)
Peptidases [BR:ssc01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100523071 (USP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
6
AA seq 786 aa AA seqDB search
MPGVIPXPSESNGLSRGSPSKKNRLSLKFFQKKETKRALDFTDSQENEEKTSEYRGSEVD
QVVPAAQSSPINCEKRENLLPFVGLNNLGNTCYLNSILQVLYFCPGFKSGVKHLFNIISR
KKEALKDEANQKEKGNGNCKEDSLASYELICSLQSLIISVEQLQASFLLNPEKYTDELAT
QPRRLLNTLRELNPMYEGYLQHDAQEVLQCILGNIQETCQLLKKEEVKNVTELSKVEEKH
QKEEMSGNDSMEMDNMKHSEDYKEKLPKGNGKRKSDTEFGNMKKKVKVCKEHQSLEENQR
QTRSKRKATGDTLEIPPKINPKYISENESGRPSQKKSRVKINWLKSSAKQPSILSKFCSL
GKITTNQGSKGQSKENEYDVEEDLGKCENDNTTNGCGLESPGNNVMPINVNEVKPINKGA
EQIGFELVEKLFQGQLVLRTRCLECESLTERREDFQDISVPVQEDELSKVEESSEISPEP
KTEMKTLRWAISQFASVERIVGEDKYFCENCHHYTEAERSLLFDKMPEVITIHLKCFAAS
GLEFDCYGGGLSKINTPLLTPLKLSLEEWSTKPTNDSYGLFAVVMHSGITISSGHYTASV
KVTDLNSLELDKENFVIDQMCEVGKPEPLNEEEARGVVENYDDEEVSIRVSGSTQPSKVL
NKKNVEAIGLLGGQKSKADYELYNKASNPDKVASTALAENRNSETNTNGTHESDRNKESS
DQIGINISGFENKISYIVQSLKEYEGKWLLFDDSEVKVTEEKDFLNSLSPSTSPTSTPYL
LFYKKL
NT seq 2361 nt NT seq  +upstreamnt  +downstreamnt
atgcctggtgtcatacctagncctagtgaaagtaatgggctttcaagaggtagtccatcc
aaaaaaaacagactttccttgaagttttttcagaaaaaggaaaccaagagagccttggat
ttcacagattctcaagaaaatgaagaaaaaacttctgaatacagaggatctgaagtcgat
caagttgttcctgcagcacagtcctcacctataaactgtgagaagagagaaaacttgtta
ccatttgtgggactgaataatctcggcaatacttgttatcttaatagtatccttcaggta
ttatatttctgtcctggttttaaatctggagtgaagcacttatttaatattatttcaagg
aagaaggaagccctgaaagatgaagccaatcaaaaagaaaagggaaatggaaattgcaaa
gaagattctttagcaagttatgaactaatatgcagcttacagtccttgatcatttcagtt
gaacagcttcaggctagttttctcttaaatccagagaaatatactgatgaacttgctact
cagccaaggcgactgcttaacacactcagggaactcaaccctatgtatgaaggatatcta
cagcatgatgcacaggaagtgttacagtgtattttgggaaatattcaagaaacatgccaa
ctcttaaaaaaagaagaagtaaaaaatgtgacagagttatctaaggtagaagaaaaacat
cagaaagaggaaatgagtggtaatgacagcatggagatggacaacatgaagcattctgaa
gactataaagaaaaactcccaaaaggaaatgggaaaagaaaaagtgacactgaatttggt
aacatgaagaaaaaagttaaagtctgtaaggaacatcagtctttggaagaaaaccagaga
caaaccagatccaaaagaaaagctacaggtgatacattagagattcctcctaaaataaac
cccaaatacatttctgaaaatgagagtggaagaccctcacaaaagaaatcaagagttaaa
ataaattggttaaagtcttcagctaagcaacccagcattctttctaaattctgtagtctg
gggaaaataacaacaaaccaaggatccaagggacaatctaaagaaaatgagtatgatgtt
gaagaggacttgggaaagtgtgaaaatgataacacaactaatggttgtggacttgaatct
ccagggaataatgttatgcccattaatgttaatgaagttaagcccataaacaaaggtgca
gagcaaattggttttgagttagtcgagaaattatttcaaggtcaactggtattaaggact
cgttgcttagagtgtgaaagtttaacagagagaagagaagattttcaagacatcagtgta
ccagtgcaagaagatgaactttccaaagtagaggaaagttctgaaatttctccagagcca
aaaacagaaatgaagaccctgagatgggcaatttcacagtttgcttcagtggagaggatt
gtaggagaagataaatatttctgtgaaaattgccatcattacactgaagctgaacgaagt
cttttgtttgacaaaatgcctgaagttataactattcatttgaagtgctttgctgctagt
ggcttggagtttgattgttatggtggtggactttccaagatcaacactcctttactgaca
cctcttaaattgtcactggaagaatggagcacaaagccaaccaacgacagctatggatta
tttgcagttgtaatgcatagtggcattacaattagtagcgggcattatactgcttctgtt
aaagtcactgaccttaacagtttagaactagataaggaaaactttgtgatcgaccaaatg
tgtgaagtaggtaagccagaaccactcaatgaggaggaagcgaggggtgtggttgaaaat
tatgatgatgaagaagtgtccattagagtcagtggaagtacccagccaagtaaagttttg
aacaaaaaaaatgtagaagctattggacttcttggaggacaaaagagcaaagcagattat
gagttatacaacaaagcatctaatcctgataaagttgccagtacagcacttgctgaaaac
agaaattctgagactaatactaatgggacccatgaatctgatagaaacaaggaatccagt
gaccaaataggcattaatattagtggatttgagaacaagatttcgtacatagtgcaaagc
ttaaaggagtatgaggggaagtggttgctttttgatgattctgaagtgaaagttactgaa
gagaaggacttcttgaattctctttccccttctacatctcctacatctactccttacttg
ctattttataagaagttatag

DBGET integrated database retrieval system