KEGG   Sus scrofa (pig): 100523151Help
Entry
100523151         CDS       T01009                                 

Gene name
NUP205
Definition
nucleoporin 205kDa
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
ssc  Sus scrofa (pig)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100523151 (NUP205)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
18
AA seq 873 aa AA seqDB search
MDAERAYPFSGEEFFKNSTDLINLSTHFFTTLHPVHTNSVYSFLTPKLEKKLAGIRHETR
IHILNLLITSLERNPPNLALYLLGFELKKPVSTTNLQDPGVLGCPRTCLHAILNILEKGT
EGRTGPVAVRESPQLAELCYQVIYQLCACSDTSGPTMRYLRTSQDFLFSQLQHLPFSNKE
YEISMLNQMSWLMKTASIELRVTSLNRQRSHTQRLLHLLLDDMPVKPYSDGEGGLEDENR
SVSGFLHFDTATKVRRKILSILDSIDFSQEIPEPLQLDFFDRAQIEQVIANCEHKNLRGQ
TVCNVKLLHRVLVAEVNALQGMAAIGQRPLLMEEISTILQYVVGRNKLLQCLHAKRHALE
SWRQLVEIILTACPQDLIQAEDRQLIIRDILQDVHDKILDDEAAQELMPVVAGAVFTLTA
HLSQAVRTEQKQPLVLGPGEAHYAFMLDSSFTSPPPAENPVVGFASIGDSSLHIILKKLL
DFILKTGGGFQRVRTHLYGSLLYYLQIAQRPDEPDTLEAAKKTMWERLTAPEDVFSKLQR
ENIAIIESYGAALMEVVCRDACDGHEIGRMLALALLDRIVSVDKQQQWLLYLSNSGYLKV
LVDSLVEDDRTLQSLLTPQPPLLKALYTYESKMAFLTRVAKIQQGALELLRSGVIVRLAQ
CQVYDMRPEMDPQGMFGMRDPPVFIPTPVDRYRQILLPALRLCQVILTSSMAQHLQAAGQ
VLQFLISHSDTIQAILRCQDVSAGSLQELALLTGIISKAALPGILSELDVDVNEGSLMEL
QGHIGRFQRQCLGLLSRFGGSDRLRQFKFQDDNVEGDRVSKKDEVELAMQQICANVMEYC
QSLMLQSSPTFQHGVCLFTPSLSETSNRDGPRQ
NT seq 2620 nt NT seq  +upstreamnt  +downstreamnt
atggacgctgagagagcttaccctttttctggtgaagagttcttcaagaactctacggac
cttataaacctttccacccatttcttcaccaccctccaccctgtgcatacaaattcagtt
tatagcttcctgaccccaaaactggaaaagaaattagctggaatccgtcacgaaacaaga
atccacatcttgaatcttctcatcacctctttggaacgcaatccacccaatcttgctctc
tacctattgggctttgaattaaagaaacctgtcagtaccacaaacctgcaagacccagga
gtgttaggttgccctcggacatgccttcatgccatcctgaacatcttggagaaaggaacc
gaagggaggacaggcccggtggcggtgagagaatcgcctcaactcgccgagctctgttac
caggtgatatatcagttatgtgcatgctctgatacatctggtcctactatgagatacttg
agaaccagccaggatttcttattttctcagttgcaacatttaccattttctaacaaagaa
tatgaaatctctatgctgaaccagatgtcatggctgatgaagacggcctcaatagaacta
agggtaacttctctgaatcgccaaaggtcacacacccagaggctcctgcacctcttactg
gatgacatgccagtgaaaccatactcagatggggaaggaggattagaagatgaaaatagg
tctgtctctggattcctgcactttgacactgctaccaaagtacgtcgaaaaattctcagt
attcttgactccattgacttcagtcaggagatccctgagcctttacagttggatttcttt
gatcgagcccagattgaacaagtaatcgctaactgtgaacacaagaatttacggggacag
acagtctgcaatgtcaagcttcttcatagagttcttgttgctgaagtaaatgcccttcag
ggtatggcagccataggacagagacctctactaatggaggagatcagcactattcttcag
tacgtggtaggaagaaacaaattgctgcagtgtcttcatgcaaaacggcatgcgctggag
tcatggaggcagctggtagagatcatactgacagcttgtccccaggacctaattcaggca
gaagatcgacaactgattattcgtgatattttacaagatgtgcatgataagatcctcgat
gatgaagccgcacaggagttaatgccagtggtagcaggtgccgtgttcaccctgaccgct
cacctaagccaagccgttcgcacagaacagaagcaaccgttagtcttgggacctggagag
gcccattatgcttttatgcttgatagctctttcacctcacctccgccagcagagaaccct
gtggtggggtttgcttctattggagattcttcacttcacatcatattgaagaaactctta
gacttcattttgaagacaggtggtgggttccagcgagtgaggacacacctgtatggctct
ctgctgtattacttacagattgcccagagaccagatgaaccagacaccttagaagcagcc
aagaaaaccatgtgggaaaggctgacagcccctgaagatgtatttagtaaattacaacga
gaaaacatagccatcattgagagctatggtgccgccctcatggaagtggtctgtcgagat
gcttgtgatggtcatgagattggaaggatgctggcactggctctgcttgatcggattgtt
tctgtagataagcagcagcagtggcttttgtatctttcgaacagtggctatttgaaggtg
cttgtggacagcttggtagaagatgaccgcactttgcagagcttactcactccacagcct
ccccttttaaaagctctttacacttatgaatccaaaatggcatttctcacaagagtggcc
aagatacagcagggtgctttagagctactgaggtctggagttattgtgagactggcacag
tgccaagtctatgacatgcgcccagaaatggacccacagggcatgtttggcatgagagac
ccaccagtgttcatccctactccggtggaccggtaccgccagattctccttcctgctctc
cgtttgtgccaggtcatcctcacgtctagtatggcccagcacttgcaggcagcagggcag
gtgttgcagtttctcatttcgcattctgataccatacaggcaatcctgcgctgtcaggat
gttagtgctgggtctttgcaggaattggctctgctgacaggaattataagtaaagcagca
cttcctggtatattaagtgaactcgatgttgatgtaaatgaaggatctctaatggagcta
cagggacatatcggcagattccagcgccagtgcttaggactgctgagtcgctttggaggt
tcagacagactgcgtcagtttaaatttcaagatgataatgtggagggagatagagtgagc
aagaaagatgaggtcgaactggctatgcaacagatttgtgccaatgtcatggaatattgc
cagtcactcatgttacagagttcccctacctttcagcatggtgtgtgtctctttacccct
agcctgtccgaaaccagtaatagagatgggcctcggcaag

DBGET integrated database retrieval system