KEGG   Sus scrofa (pig): 100523151Help
Entry
100523151         CDS       T01009                                 

Gene name
NUP205
Definition
(RefSeq) nuclear pore complex protein Nup205 isoform X1
  KO
K14310  
nuclear pore complex protein Nup205
Organism
ssc  Sus scrofa (pig)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100523151 (NUP205)
Messenger RNA biogenesis [BR:ssc03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     100523151 (NUP205)
Chromosome [BR:ssc03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    100523151 (NUP205)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
18
AA seq 1844 aa AA seqDB search
MTTRFTDELMEQGLTYKVLTLVSQIDVNNEFEKLQRERGLGSEKHRKEVSDLIKECRQSL
AESLFAWACQSPLGKDDTLLLIGHLERVSVEANGSLDAVNLALLMALLYCFDISFIEQST
EERDDMIHQLPLLTERQYIATVHSRLQDSQPWKLPGLQATVRLAWALALRGISQLPDVTA
LAEFTEADEAMAELAVADNVFLFLTEAVVVSENFYQEEFYIRRIHNLITDFLALMPMKVK
QLRNRADEDARMIHMSMQMGNEPPISLRRDLEHLMLLIGELYKKNPFNLELALEYWCPSE
PLQTSTILGSYLGVAHQRPPQRQVVLSKFVRQMGDLLPPTIYIPYLKMLQGLANGPQCAH
YCFSLLKVNGSSHVENIQGAGGSPVSWEHFFHSLMLYHEHLRKDLPSADSVQYRHLPSRG
ITQKEQDGLIAFLQLTSTIITWSENARLALCEHPQWTPVVVILGLLQCSIPPVLKAELLK
TLAAFGKSPEIAASLWQSLEYTQILQTVRVPSQRQAIGIEVELNEIESRCEEYPLTRAFC
HLISTLVESSFPSNLGAGLRPPGFDPYLQFLRDSVFLRFRTRAYRRAAEKWEVAEVVLEV
FYKLLRDYEPQLEDFVDQFVELQGEEIIAYKPPGFSLMYHLLNESPMLELALSLLEEGVK
QLDTYAPFPGKKHLEKAVQHCLALLNLTLQKENLFMDLLRESQLALIVSPLEQLLQGINP
RTKKADNVVNIARYLYHGNTNPELAFESAKILCCISCNSNIQIKLVGDFTHDQSISQRLM
AGFVECLDSEDMEEFVRLEEGSELEKKLAGIRHETRIHILNLLITSLERNPPNLALYLLG
FELKKPVSTTNLQDPGVLGCPRTCLHAILNILEKGTEGRTGPVAVRESPQLAELCYQVIY
QLCACSDTSGPTMRYLRTSQDFLFSQLQHLPFSNKEYEISMLNQMSWLMKTASIELRVTS
LNRQRSHTQRLLHLLLDDMPVKPYSDGEGGLEDENRSVSGFLHFDTATKVRRKILSILDS
IDFSQEIPEPLQLDFFDRAQIEQVIANCEHKNLRGQTVCNVKLLHRVLVAEVNALQGMAA
IGQRPLLMEEISTILQYVVGRNKLLQCLHAKRHALESWRQLVEIILTACPQDLIQAEDRQ
LIIRDILQDVHDKILDDEAAQELMPVVAGAVFTLTAHLSQAVRTEQKQPLVLGPGEAHYA
FMLDSSFTSPPPAENPVVGFASIGDSSLHIILKKLLDFILKTGGGFQRVRTHLYGSLLYY
LQIAQRPDEPDTLEAAKKTMWERLTAPEDVFSKLQRENIAIIESYGAALMEVVCRDACDG
HEIGRMLALALLDRIVSVDKQQQWLLYLSNSGYLKVLVDSLVEDDRTLQSLLTPQPPLLK
ALYTYESKMAFLTRVAKIQQGALELLRSGVIVRLAQCQVYDMRPEMDPQGMFGMRDPPVF
IPTPVDRYRQILLPALRLCQVILTSSMAQHLQAAGQVLQFLISHSDTIQAILRCQDVSAG
SLQELALLTGIISKAALPGILSELDVDVNEGSLMELQGHIGRFQRQCLGLLSRFGGSDRL
RQFKFQDDNVEGDRVSKKDEVELAMQQICANVMEYCQSLMLQSSPTFQHGVCLFTPSLSE
TSNRDGPRQDTQAPVVPYWRLPGLGIIVYLLKQSANDFFSYYDSHRRSVNKLQNVEQLPP
DEIKELCQSVMPAGVDKISTAQKYVLARRRLVKLINNRAKLLSLCSFIIETCLFILWRHL
EYYLLHCTPTDSQESLFASRTLFKSRRLQDSFTSESNLDFRSGLTIVSQHDLDQLQADTI
NAFGESLQKKLLDIEGLYSKVRSRYSFIQALVRRVRGLLRISRN
NT seq 5535 nt NT seq  +upstreamnt  +downstreamnt
atgacaacacggtttaccgatgagctgatggagcaaggattgacttacaaagtccttact
ctggtgtcacagattgatgttaacaatgagtttgaaaaactgcagcgcgagagaggtttg
ggcagtgaaaaacatcgaaaagaggtttccgatctcatcaaggagtgcaggcagtctctg
gcagaaagcctttttgcctgggcttgccagtcacctttaggcaaagatgacaccctactc
cttattggacatttggaaagagtttcagttgaggctaatggctcgttggatgcagtgaat
ctggctcttcttatggcgcttctgtactgcttcgacatcagctttatagaacaaagcaca
gaggaacgtgatgatatgattcatcagcttccactgttgacagagaggcagtacattgca
acagttcactctcgccttcaagactcacagccctggaaactgccggggctgcaagccacc
gtgagacttgcctgggcactggcgttgagggggatatctcagctacctgatgtgacagct
ctggctgaattcacagaagcagatgaagccatggcagagcttgcagttgctgacaacgtt
ttcttgttcctcactgaagccgtggtggtgtcagaaaacttctatcaggaggagttttat
attcgtagaatccataatctcatcacagatttcttggcacttatgccaatgaaggtgaag
cagctgaggaatcgagcagatgaagatgctcgaatgattcacatgagcatgcagatgggc
aatgaaccccccatttcacttagacgagatctggaacacttaatgctcctgattggtgag
ctttataaaaagaacccttttaatttggagcttgcgctagaatattggtgtccctcagag
cctcttcagacttccactatcctgggttcttaccttggggtggctcatcagcgaccccct
caacgccaggttgtcttgtcaaagtttgtcaggcaaatgggtgacctgttgcctccaact
atttacattccttacttgaaaatgctccagggattggccaatgggccccagtgcgcccac
tactgttttagcctgctcaaagtcaatggtagcagtcatgttgaaaacattcaaggagca
ggcggcagtcctgtttcctgggaacatttctttcactccttgatgctttaccacgaacac
ctccggaaggatcttccgagtgcggatagtgtccagtaccgtcaccttccttcacgtggc
atcacccagaaggagcaagatggattgattgcctttttacagctcacatctaccatcatt
acttggagtgaaaatgctcgcttggcactctgtgaacatcctcagtggacccctgtcgtg
gtgattctgggactcctgcagtgcagtattcctcctgttctaaaggccgaactactgaag
acacttgcagcatttggaaaatctcctgaaattgccgcttccctctggcagtcgttggaa
tacactcagatactgcagaccgtaagggtgccaagccagaggcaagctattggtattgag
gtggaactaaatgaaatagaatcccggtgtgaagaatacccattgactcgtgctttttgc
catctaattagcaccctggtagagagctcctttccttctaatttgggtgctggactgcgg
ccccccggctttgacccttatttgcagtttcttagagattccgtgtttctccgattccgc
acaagagcttaccggagagccgctgaaaagtgggaagttgctgaggttgttttggaggtg
ttctataaattgctcagagattatgaacctcaacttgaagattttgtagatcagtttgtg
gaactacaaggagaagaaatcatagcctataagccaccaggatttagtctgatgtatcat
cttctgaacgagtccccaatgttggagcttgctcttagtttattggaggaaggcgtaaag
cagcttgacacctatgctcctttccctgggaagaaacatcttgagaaagcagtgcagcat
tgccttgcacttcttaatctaaccctgcaaaaggaaaacctcttcatggatcttctgaga
gaaagtcagctggctctaatagtctctcctttagagcagctcttgcagggaatcaatcct
agaactaagaaggctgataacgtggtgaacattgccagatacctatatcatggcaatact
aatccagaattggcttttgagagtgccaagatcctctgctgtatctcttgcaattccaat
attcagataaaattggttggagatttcacacatgaccagagtataagtcagaggctgatg
gctggatttgtagagtgtttggatagtgaagatatggaagaatttgtacgtctagaagaa
ggatcagaactggaaaagaaattagctggaatccgtcacgaaacaagaatccacatcttg
aatcttctcatcacctctttggaacgcaatccacccaatcttgctctctacctattgggc
tttgaattaaagaaacctgtcagtaccacaaacctgcaagacccaggagtgttaggttgc
cctcggacatgccttcatgccatcctgaacatcttggagaaaggaaccgaagggaggaca
ggcccggtggcggtgagagaatcgcctcaactcgccgagctctgttaccaggtgatatat
cagttatgtgcatgctctgatacatctggtcctactatgagatacttgagaaccagccag
gatttcttattttctcagttgcaacatttaccattttctaacaaagaatatgaaatctct
atgctgaaccagatgtcatggctgatgaagacggcctcaatagaactaagggtaacttct
ctgaatcgccaaaggtcacacacccagaggctcctgcacctcttactggatgacatgcca
gtgaaaccatactcagatggggaaggaggattagaagatgaaaataggtctgtctctggg
ttcctgcactttgacactgctaccaaagtacgtcgaaaaattctcagtattcttgactcc
attgacttcagtcaggagatccctgagcctttacagttggatttctttgatcgagcccag
attgaacaagtaatcgctaactgtgaacacaagaatttacggggacagacagtctgcaat
gtcaagcttcttcatagagttcttgttgctgaagtaaatgcccttcagggtatggcagcc
ataggacagagacctcttctaatggaggagatcagcactattcttcagtacgtggtagga
agaaacaaattgctgcagtgtcttcatgcaaaacggcatgcgctggagtcatggaggcag
ctggtagagatcatactgacagcttgtccccaggacctaattcaggcagaagatcgacaa
ctgattattcgtgatattttacaagatgtgcatgataagatcctcgatgatgaagccgca
caggagttaatgccagtggtagcaggtgccgtgttcaccctgaccgctcacctaagccaa
gccgttcgcacagaacagaagcaaccgttagtcttgggacctggagaggcccattatgct
tttatgcttgatagctctttcacctcacctccgccagcggagaaccctgtggtggggttt
gcttctattggagattcttcacttcacatcatattgaagaaactcttagacttcattttg
aagacaggtggtgggttccagcgagtgaggacacacctgtatggctctctgctgtattac
ttacagattgcccagagaccagatgaaccagacaccttagaagcagccaagaaaaccatg
tgggaaaggctgacagcccctgaagatgtatttagtaaattacaacgagaaaacatagcc
atcattgagagctatggtgccgccctcatggaagtggtctgtcgagatgcttgtgatggt
catgagattggaaggatgctggcactggctctgcttgatcggattgtttctgtagataag
cagcagcagtggcttttgtatctttcgaacagtggctatttgaaggtgcttgtggacagc
ttggtagaagatgaccgcactttgcagagcttactcactccacagcctccccttttaaaa
gctctttacacttatgaatccaaaatggcatttctcacaagagtggccaagatacagcag
ggtgctttagagctactgaggtctggggttattgtgagactggcacagtgccaagtctat
gacatgcgcccagaaatggacccacagggcatgtttggcatgagagacccaccagtgttc
atccctactccggtggaccggtaccgccagattctccttcctgctctccgtttgtgccag
gtcatcctcacgtctagtatggcccagcacttgcaggcagcagggcaggtgttgcagttt
ctcatttcgcattctgataccatacaggcaatcctgcgctgtcaggatgttagtgctggg
tctttgcaggaattggctctgctgacaggaattataagtaaagcagcacttcctggtata
ttaagtgaactcgatgttgatgtaaatgaaggatctctaatggagctacagggacatatc
ggcagattccagcgccagtgcttaggactgctgagtcgctttggaggttcagacagactg
cgtcagtttaaatttcaagatgataatgtggagggagatagagtgagcaagaaagatgag
gtcgaactggctatgcaacagatttgtgccaatgtcatggaatattgccagtcactcatg
ttacagagttcccctacctttcagcatggtgtgtgtctctttacccctagcctgtccgaa
accagtaatagagatgggcctcggcaagacacccaagctccagtggttccatactggcgg
ctgcctggtttgggcattattgtctacctgctgaaacagagtgctaatgatttcttcagc
tactatgacagtcatcgacggagtgtcaacaagctgcagaatgtggagcaacttccccca
gatgagataaaagagttgtgccagtctgtgatgcctgctggtgttgataaaatctccact
gcccagaaatatgttttagcaagaaggcgtttggtgaagctgatcaacaatagggctaaa
ctgctctccctttgttcctttatcatagaaacctgcctgttcattctctggcgccatctg
gagtactacttgttacactgcacacccacggattctcaagagtccttgtttgcctccagg
accttatttaaaagcagaagactgcaagattccttcacttcagaaagcaatctggatttt
agaagtgggctgactatagtgagccaacatgatttagaccagcttcaggctgacaccatc
aatgcttttggagaatcactgcagaagaaacttctggacattgaaggattgtattcaaaa
gttcgatcccgctacagtttcatacaagctcttgtcagacgtgtccgaggcctactgagg
atatcacggaactga

DBGET integrated database retrieval system