KEGG   Sus scrofa (pig): 100523151Help
Entry
100523151         CDS       T01009                                 

Gene name
NUP205
Definition
nucleoporin 205kDa
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
ssc  Sus scrofa (pig)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100523151 (NUP205)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
18
AA seq 873 aa AA seqDB search
MDAERAYPFSGEEFFKNSTDLINLSTHFFTTLHPVHTNSVYSFLTPKLEKKLAGIRHETR
IHILNLLITSLERNPPNLALYLLGFELKKPVSTTNLQDPGVLGCPRTCLHAILNILEKGT
EGRTGPVAVRESPQLAELCYQVIYQLCACSDTSGPTMRYLRTSQDFLFSQLQHLPFSNKE
YEISMLNQMSWLMKTASIELRVTSLNRQRSHTQRLLHLLLDDMPVKPYSDGEGGLEDENR
SVSGFLHFDTATKVRRKILSILDSIDFSQEIPEPLQLDFFDRAQIEQVIANCEHKNLRGQ
TVCNVKLLHRVLVAEVNALQGMAAIGQRPLLMEEISTILQYVVGRNKLLQCLHAKRHALE
SWRQLVEIILTACPQDLIQAEDRQLIIRDILQDVHDKILDDEAAQELMPVVAGAVFTLTA
HLSQAVRTEQKQPLVLGPGEAHYAFMLDSSFTSPPPAENPVVGFASIGDSSLHIILKKLL
DFILKTGGGFQRVRTHLYGSLLYYLQIAQRPDEPDTLEAAKKTMWERLTAPEDVFSKLQR
ENIAIIESYGAALMEVVCRDACDGHEIGRMLALALLDRIVSVDKQQQWLLYLSNSGYLKV
LVDSLVEDDRTLQSLLTPQPPLLKALYTYESKMAFLTRVAKIQQGALELLRSGVIVRLAQ
CQVYDMRPEMDPQGMFGMRDPPVFIPTPVDRYRQILLPALRLCQVILTSSMAQHLQAAGQ
VLQFLISHSDTIQAILRCQDVSAGSLQELALLTGIISKAALPGILSELDVDVNEGSLMEL
QGHIGRFQRQCLGLLSRFGGSDRLRQFKFQDDNVEGDRVSKKDEVELAMQQICANVMEYC
QSLMLQSSPTFQHGVCLFTPSLSETSNRDGPRQ
NT seq 2620 nt NT seq  +upstreamnt  +downstreamnt
atggacgctgagagagcttaccctttttctggtgaagagttcttcaagaactctacggac
cttataaacctttccacccatttcttcaccaccctccaccctgtgcatacaaattcagtt
tatagcttcctgaccccaaaactggaaaagaaattagctggaatccgtcacgaaacaaga
atccacatcttgaatcttctcatcacctctttggaacgcaatccacccaatcttgctctc
tacctattgggctttgaattaaagaaacctgtcagtaccacaaacctgcaagacccagga
gtgttaggttgccctcggacatgccttcatgccatcctgaacatcttggagaaaggaacc
gaagggaggacaggcccggtggcggtgagagaatcgcctcaactcgccgagctctgttac
caggtgatatatcagttatgtgcatgctctgatacatctggtcctactatgagatacttg
agaaccagccaggatttcttattttctcagttgcaacatttaccattttctaacaaagaa
tatgaaatctctatgctgaaccagatgtcatggctgatgaagacggcctcaatagaacta
agggtaacttctctgaatcgccaaaggtcacacacccagaggctcctgcacctcttactg
gatgacatgccagtgaaaccatactcagatggggaaggaggattagaagatgaaaatagg
tctgtctctggattcctgcactttgacactgctaccaaagtacgtcgaaaaattctcagt
attcttgactccattgacttcagtcaggagatccctgagcctttacagttggatttcttt
gatcgagcccagattgaacaagtaatcgctaactgtgaacacaagaatttacggggacag
acagtctgcaatgtcaagcttcttcatagagttcttgttgctgaagtaaatgcccttcag
ggtatggcagccataggacagagacctctactaatggaggagatcagcactattcttcag
tacgtggtaggaagaaacaaattgctgcagtgtcttcatgcaaaacggcatgcgctggag
tcatggaggcagctggtagagatcatactgacagcttgtccccaggacctaattcaggca
gaagatcgacaactgattattcgtgatattttacaagatgtgcatgataagatcctcgat
gatgaagccgcacaggagttaatgccagtggtagcaggtgccgtgttcaccctgaccgct
cacctaagccaagccgttcgcacagaacagaagcaaccgttagtcttgggacctggagag
gcccattatgcttttatgcttgatagctctttcacctcacctccgccagcagagaaccct
gtggtggggtttgcttctattggagattcttcacttcacatcatattgaagaaactctta
gacttcattttgaagacaggtggtgggttccagcgagtgaggacacacctgtatggctct
ctgctgtattacttacagattgcccagagaccagatgaaccagacaccttagaagcagcc
aagaaaaccatgtgggaaaggctgacagcccctgaagatgtatttagtaaattacaacga
gaaaacatagccatcattgagagctatggtgccgccctcatggaagtggtctgtcgagat
gcttgtgatggtcatgagattggaaggatgctggcactggctctgcttgatcggattgtt
tctgtagataagcagcagcagtggcttttgtatctttcgaacagtggctatttgaaggtg
cttgtggacagcttggtagaagatgaccgcactttgcagagcttactcactccacagcct
ccccttttaaaagctctttacacttatgaatccaaaatggcatttctcacaagagtggcc
aagatacagcagggtgctttagagctactgaggtctggagttattgtgagactggcacag
tgccaagtctatgacatgcgcccagaaatggacccacagggcatgtttggcatgagagac
ccaccagtgttcatccctactccggtggaccggtaccgccagattctccttcctgctctc
cgtttgtgccaggtcatcctcacgtctagtatggcccagcacttgcaggcagcagggcag
gtgttgcagtttctcatttcgcattctgataccatacaggcaatcctgcgctgtcaggat
gttagtgctgggtctttgcaggaattggctctgctgacaggaattataagtaaagcagca
cttcctggtatattaagtgaactcgatgttgatgtaaatgaaggatctctaatggagcta
cagggacatatcggcagattccagcgccagtgcttaggactgctgagtcgctttggaggt
tcagacagactgcgtcagtttaaatttcaagatgataatgtggagggagatagagtgagc
aagaaagatgaggtcgaactggctatgcaacagatttgtgccaatgtcatggaatattgc
cagtcactcatgttacagagttcccctacctttcagcatggtgtgtgtctctttacccct
agcctgtccgaaaccagtaatagagatgggcctcggcaag

DBGET integrated database retrieval system