KEGG   Sus scrofa (pig): 100523190Help
Entry
100523190         CDS       T01009                                 

Definition
cytochrome P450 2F1-like
Orthology
K07416  
cytochrome P450, family 2, subfamily F [EC:1.14.14.1]
Organism
ssc  Sus scrofa (pig)
Pathway
Metabolism of xenobiotics by cytochrome P450
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100523190
Enzymes [BR:ssc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100523190
Cytochrome P450 [BR:ssc00199]
 Cytochrome P450, animal type
  CYP2 family
   100523190
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
6
AA seq 362 aa AA seqDB search
MLSCLGWMSCAPALLHTVSPEPHTLTHSPPPSGKPFDPTILLSRSVSNIICSVLFGSRFD
YEDERLLNIVQLINDNFQIMSSFWGEMYNIFPNLLDWVPGPHRRLFQNFDRMKNLIALSV
RDHQASHDPKSPRDFIDCFLTKIAEEKQDPLSHFHMDTLLMTTHNLLFGGTETVGTTLRH
TFLLLMKYPKVQARVQEEIDNVVGRARLPVLEDRTAMPYTDAVIHEAQRFADIIPMNLPH
RLIRDTVFRGFLLPKGTDVITLLNTVHNDPSQFLTPREFNPEHFLDANQSFKKSPAFMPF
SAGRRLCLGESLARMELFLYLTAILQSFSLQPLGAPEDIDLTPISTGLGNVPRPFQLYLR
AR
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgctgtcatgcttgggttggatgtcttgcgctccagcgctgttgcacactgtgtctccc
gagccgcacaccctgacccattcgcctccaccctcaggcaagcccttcgaccccacgatt
ttgctgagccgctccgtgtccaatattatctgctctgtgctcttcggcagccgctttgac
tacgaggatgagcgcctgctcaacattgtccagctcataaatgacaacttccaaattatg
agcagcttctggggagagatgtacaatatctttccgaacctcctggactgggtgcccggt
ccacatcgacgtcttttccagaactttgaccgcatgaaaaaccttatcgctctcagcgtc
cgtgaccaccaagcctcccacgacccaaagtctccccgggacttcattgattgcttcctt
accaagatagcagaagagaagcaggaccctctgagccacttccacatggatactctgctg
atgaccacacataatctgctctttggtggtaccgagaccgtgggcaccacgctgcgccac
accttcctcctgctcatgaagtacccaaaagtgcaagcccgcgtacaggaggagatcgac
aatgtggtgggacgcgcgcggctgccggtgctggaagaccggacggccatgccttatacg
gatgcggtgatccacgaggcgcagcgcttcgcagacatcatccccatgaacctgccacac
cgcctcattcgggacacggtctttcgaggcttcctgctacccaagggcacggatgtcatc
accctccttaatacagtccacaacgaccccagccaatttctgacgccgcgggaattcaac
cctgagcattttctggatgccaatcagtccttcaagaagagccctgccttcatgcccttc
tcagccggacgccggttgtgcctgggcgagtcgctggcgcgcatggagctctttctctac
ctaaccgccatcctgcagagcttctcgctgcagccgctgggggcgcccgaggacatcgat
ctgaccccaatcagcaccggtctcggcaacgtgccgcggccgttccagctgtacctgcgc
gcacgctga

DBGET integrated database retrieval system