KEGG   Sus scrofa (pig): 100523190Help
Entry
100523190         CDS       T01009                                 

Definition
cytochrome P450 2F1-like
Orthology
K07416  
cytochrome P450, family 2, subfamily F [EC:1.14.14.1]
Organism
ssc  Sus scrofa (pig)
Pathway
Metabolism of xenobiotics by cytochrome P450
Class
Metabolism; Xenobiotics biodegradation and metabolism; Metabolism of xenobiotics by cytochrome P450 [PATH:ssc00980]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
6
AA seq 362 aa AA seqDB search
MLSCLGWMSCAPALLHTVSPEPHTLTHSPPPSGKPFDPTILLSRSVSNIICSVLFGSRFD
YEDERLLNIVQLINDNFQIMSSFWGEMYNIFPNLLDWVPGPHRRLFQNFDRMKNLIALSV
RDHQASHDPKSPRDFIDCFLTKIAEEKQDPLSHFHMDTLLMTTHNLLFGGTETVGTTLRH
TFLLLMKYPKVQARVQEEIDNVVGRARLPVLEDRTAMPYTDAVIHEAQRFADIIPMNLPH
RLIRDTVFRGFLLPKGTDVITLLNTVHNDPSQFLTPREFNPEHFLDANQSFKKSPAFMPF
SAGRRLCLGESLARMELFLYLTAILQSFSLQPLGAPEDIDLTPISTGLGNVPRPFQLYLR
AR
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgctgtcatgcttgggttggatgtcttgcgctccagcgctgttgcacactgtgtctccc
gagccgcacaccctgacccattcgcctccaccctcaggcaagcccttcgaccccacgatt
ttgctgagccgctccgtgtccaatattatctgctctgtgctcttcggcagccgctttgac
tacgaggatgagcgcctgctcaacattgtccagctcataaatgacaacttccaaattatg
agcagcttctggggagagatgtacaatatctttccgaacctcctggactgggtgcccggt
ccacatcgacgtcttttccagaactttgaccgcatgaaaaaccttatcgctctcagcgtc
cgtgaccaccaagcctcccacgacccaaagtctccccgggacttcattgattgcttcctt
accaagatagcagaagagaagcaggaccctctgagccacttccacatggatactctgctg
atgaccacacataatctgctctttggtggtaccgagaccgtgggcaccacgctgcgccac
accttcctcctgctcatgaagtacccaaaagtgcaagcccgcgtacaggaggagatcgac
aatgtggtgggacgcgcgcggctgccggtgctggaagaccggacggccatgccttatacg
gatgcggtgatccacgaggcgcagcgcttcgcagacatcatccccatgaacctgccacac
cgcctcattcgggacacggtctttcgaggcttcctgctacccaagggcacggatgtcatc
accctccttaatacagtccacaacgaccccagccaatttctgacgccgcgggaattcaac
cctgagcattttctggatgccaatcagtccttcaagaagagccctgccttcatgcccttc
tcagccggacgccggttgtgcctgggcgagtcgctggcgcgcatggagctctttctctac
ctaaccgccatcctgcagagcttctcgctgcagccgctgggggcgcccgaggacatcgat
ctgaccccaatcagcaccggtctcggcaacgtgccgcggccgttccagctgtacctgcgc
gcacgctga

DBGET integrated database retrieval system