KEGG   Sus scrofa (pig): 100523233Help
Entry
100523233         CDS       T01009                                 

Gene name
EIF4E1B
Definition
eukaryotic translation initiation factor 4E family member 1B
Orthology
K03259  
translation initiation factor 4E
Organism
ssc  Sus scrofa (pig)
Pathway
RNA transport
HIF-1 signaling pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
Insulin signaling pathway
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100523233 (EIF4E1B)
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    100523233 (EIF4E1B)
   04151 PI3K-Akt signaling pathway
    100523233 (EIF4E1B)
   04150 mTOR signaling pathway
    100523233 (EIF4E1B)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100523233 (EIF4E1B)
Translation factors [BR:ssc03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    100523233 (EIF4E1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 248 aa AA seqDB search
MATAGPVRDAEGDVRKGQNEKEEKEKEDKEVAAGAWGGEEAPCSPRALLSLRRKAWNPGP
AKSKLELHPLLNRWALWFFKNDHSRAWQDNLQLVTKFDTVEDFWAMYSNIQLASKLSCGC
DYALFKDGIEPMWEDSRNKRGGRWLVSLAKQQRHSELDHLWLETLLCLIGESFEEHSQDV
CGAVINIRTKRDKIAVWTREAENQEGVLHIGRVYKERLGLSTKTVIGYQAHADTATKSNS
LAKNKFVV
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atggctaccgccggccctgtcagagacgctgagggtgacgtccgaaaggggcagaacgaa
aaggaggagaaagagaaagaggacaaggaggtggcagcaggggcctgggggggcgaggag
gctccgtgctctcccagggctctgctgtccctgaggaggaaggcctggaatccgggcccc
gcgaagagcaagctggagttgcacccacttctgaacaggtgggctttgtggttcttcaag
aatgaccacagccgggcctggcaggacaacttgcagctggtcaccaagtttgacaccgtg
gaggacttctgggcgatgtacagtaacatccagctggccagtaagctctcttgcggctgc
gactacgccctgttcaaggacggcattgagcccatgtgggaagacagcaggaataagcgg
ggtggccgctggctagtcagcctcgccaagcagcagcgccacagcgagctggaccacctg
tggctggagacactgctgtgtctgattggggagagctttgaggagcacagccaagacgtg
tgtggggctgtcatcaacatccgaaccaagagggacaaaattgctgtgtggacgagggag
gcagagaaccaggagggcgtgctgcacattgggcgtgtctacaaagagcgcctgggcctc
tccacaaagaccgtcattgggtaccaggctcacgcagacacggccaccaagagtaactcc
ctagccaagaacaaatttgtggtgtga

DBGET integrated database retrieval system