KEGG   Sus scrofa (pig): 100523414Help
Entry
100523414         CDS       T01009                                 

Gene name
MAPK4
Definition
(RefSeq) mitogen-activated protein kinase 4
  KO
K06855  
mitogen-activated protein kinase 4/6 [EC:2.7.11.24]
Organism
ssc  Sus scrofa (pig)
Pathway
IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Organismal Systems
  Immune system
   04657 IL-17 signaling pathway
    100523414 (MAPK4)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100523414 (MAPK4)
Protein kinases [BR:ssc01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   100523414 (MAPK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 586 aa AA seqDB search
MAEKGDCIASVYGYDLGGRFIDLQPLGFGVNGLVLSAVDSRARRKVAVKKITLSDTRSMK
HALREIKIIRRLDHDNIVKVYEVLGPKGTDLQGELFKFSVAYIVQEYMETDLARLLEQGT
LTEEHAKLFMYQLLRGLKYIHSANVLHRDLKPANIFISTEDLVLKIGDFGLARIVDQHYS
HKGYLSEGLVTKWYRSPRLLLSPNNYTKAIDMWAAGCILAEMLTGRMLFAGAHELEQMQL
ILETIPVIREEDKDELLKVMPSFVSSTWEVKRPLRKLLPEVNSEAIDFLEKILTFNPMDR
LTAEMGLQHPYMSPYSCPEDEPTSQHPFRIEDEIDDILLMADNQSQLSNWDRYPVSLSSD
LEWRPDRCQDASEVQRDPRAGSAPLVEDVQVDRAKDSQSSSERFLEHSHSSMERAFEADY
GRSCDYKVGSPSYLDKLLWRDNKPHHYSEPKLILDLSHWKQAAGAPPSAAVSAVAADAGP
RDDEPASLFLEIAQWVKSTQGGQERSSPPPDVPERRLSATPPGRPAPMDGGASPQFDLDV
FISRALKLCTKPEDLPDNKLGDLNGACISEHPGDLVQTEAFSKERW
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaaagggtgactgcatcgccagtgtctatggttatgaccttggtgggcgtttc
attgacttgcaacccctgggctttggcgtcaatgggctggtactgtccgccgtggacagc
agggcccgccggaaggtggctgtgaagaagatcaccctgagtgacacccgcagcatgaag
cacgcgctccgggagatcaagatcatccggcgcctagaccatgacaacatcgtgaaggtg
tacgaggtgctggggcccaagggcaccgacctgcagggtgaactgttcaagttcagcgtg
gcctacatcgtccaggagtacatggagactgacctggcacgcctgctggagcagggcacc
ctgacagaggagcacgccaagctgttcatgtaccagctgctccgagggctcaagtacatc
cactccgccaacgtgctgcacagggacctgaagcccgccaacatcttcatcagcacggaa
gacctcgtgctcaagatcggggattttgggttggcaaggatcgttgatcagcattactca
cacaagggttacctgtcagaaggcttggtaacaaagtggtaccgctcaccacgcctgctc
ctctcccccaacaactacaccaaagccatcgacatgtgggccgccggctgcatcctagcc
gagatgcttacggggaggatgctctttgctggggctcatgagctggagcagatgcagctc
atcctggagaccatccctgtaatccgggaggaggacaaggacgagctgctcaaagtgatg
ccttccttcgtcagcagcacctgggaggtgaagaggccgctgcgtaagctgctccctgag
gtcaacagcgaagccatcgactttctggagaagatcctgacctttaatcccatggatcgc
ctgaccgccgagatggggctgcagcacccctacatgagcccgtactcttgccccgaggat
gagcccacctcacagcaccccttccgcattgaggacgagattgatgacatcctgctgatg
gctgacaaccaaagccagctctccaactgggacaggtaccccgtgagcctgtcatcggac
ctggagtggcggcccgaccgatgccaggacgcgagcgaggtgcagcgcgacccgcgcgcg
ggctcggcgccgctggtggaggatgtgcaggtggaccgcgcaaaggactcacagagcagc
tcggagcgcttcctggagcattcgcactcgtccatggagcgcgccttcgaggccgactat
gggcgctcctgcgactacaaggtggggtcgccgtcctacctggacaagctgctgtggcgc
gacaataagccacaccactactcggagcccaagctcatcctggacctgtcgcactggaag
caggcggccggggcgccccccagtgccgcggtgtccgctgtggcggcagacgccgggccg
cgcgacgacgagccagccagcctcttcctggagatcgcgcagtgggtcaagagcacgcag
ggcggccaagagcgctccagcccgccccccgacgtccctgagcgccgcctgtcggccacc
ccaccgggtcgcccagcccccatggacgggggcgctagcccccagttcgacctggacgtg
ttcatctcccgagctctgaagctctgcaccaagcctgaggacctgccggacaacaaactg
ggcgacctcaacggcgcgtgcatctccgagcaccctggcgatctcgtgcagaccgaggcc
ttctccaaagaaaggtggtaa

DBGET integrated database retrieval system