KEGG   Sus scrofa (pig): 100523414Help
Entry
100523414         CDS       T01009                                 

Gene name
MAPK4
Definition
mitogen-activated protein kinase 4
Orthology
K06855  
mitogen-activated protein kinase 4/6 [EC:2.7.11.24]
Organism
ssc  Sus scrofa (pig)
Brite
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100523414 (MAPK4)
Protein kinases [BR:ssc01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   100523414 (MAPK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 595 aa AA seqDB search
MAEKGDCIASVYGYDLGGRFIDLQPLGFGVNGLVLSAVDSRARRKVAVKKITLSDTRSMK
HALREIKIIRRLDHDNIVKVYEVLGPKGTDLQGELFKFSVAYIVQEYMETDLARLLEQGT
LTEEHAKLFMYQLLRGLKYIHSANVLHRDLKPANIFISTEDLVLKIGDFGLARIVDQHYS
HKGYLSEGLVTKWYRSPRLLLSPNNYTKAIDMWAAGCILAEMLTGRMLFAGAHELEQMQL
ILETIPVIREEDKDELLKVMPSFVSSTWEVKRPLRKLLPEVNSEAIDFLEKILTFNPMDR
LTAEMGLQHPYMSPYSCPEDEPTSQHPFRIEDEIDDILLMADNQSQLSNWDRCSSKGFSP
EYPVSLSSDLEWRPDRCQDASEVQRDPRAGSAPLVEDVQVDRAKDSQSSSERFLEHSHSS
MERAFEADYGRSCDYKVGSPSYLDKLLWRDNKPHHYSEPKLILDLSHWKQAAGAPPSAAV
SAVAADAGPRDDEPASLFLEIAQWVKSTQGGQERSSPPPDVPERRLSATPPGRPAPMDGG
ASPQFDLDVFISRALKLCTKPEDLPDNKLGDLNGACISEHPGDLVQTEAFSKERW
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaaagggtgactgcatcgccagtgtctatggttatgaccttggtgggcgtttc
attgacttgcaacccctgggctttggcgtcaatgggctggtactgtccgccgtggacagc
agggcccgccggaaggtggctgtgaagaagatcaccctgagtgacacccgcagcatgaag
cacgcgctccgggagatcaagatcatccggcgcctagaccatgacaacatcgtgaaggtg
tacgaggtgctggggcccaagggcaccgacctgcagggtgaactgttcaagttcagcgtg
gcctacatcgtccaggagtacatggagactgacctggcacgcctgctggagcagggcacc
ctgacagaggagcacgccaagctgttcatgtaccagctgctccgagggctcaagtacatc
cactccgccaacgtgctgcacagggacctgaagcccgccaacatcttcatcagcacggaa
gacctcgtgctcaagatcggggattttgggttggcaaggatcgttgatcagcattactca
cacaagggttacctgtcagaaggcttggtaacaaagtggtaccgctcaccacgcctgctc
ctctcccccaacaactacaccaaagccatcgacatgtgggccgccggctgcatcctagcc
gagatgcttacggggaggatgctctttgctggggctcatgagctggagcagatgcagctc
atcctggagaccatccctgtaatccgggaggaggacaaggacgagctgctcaaagtgatg
ccttccttcgtcagcagcacctgggaggtgaagaggccgctgcgtaagctgctccctgag
gtcaacagcgaagccatcgactttctggagaagatcctgacctttaatcccatggatcgc
ctgaccgccgagatggggctgcagcacccctacatgagcccgtactcttgccccgaggat
gagcccacctcacagcaccccttccgcattgaggacgagattgatgacatcctgctgatg
gctgacaaccaaagccagctctccaactgggacaggtgcagttccaagggcttcagccct
gaataccccgtgagcctgtcatcggacctggagtggcggcccgaccgatgccaggacgcg
agcgaggtgcagcgcgacccgcgcgcgggctcggcgccgctggtggaggatgtgcaggtg
gaccgcgcaaaggactcacagagcagctcggagcgcttcctggagcattcgcactcgtcc
atggagcgcgccttcgaggccgactatgggcgctcctgcgactacaaggtggggtcgccg
tcctacctggacaagctgctgtggcgcgacaataagccacaccactactcggagcccaag
ctcatcctggacctgtcgcactggaagcaggcggccggggcgccccccagtgccgcggtg
tccgctgtggcggcagacgccgggccgcgcgacgacgagccagccagcctcttcctggag
atcgcgcagtgggtcaagagcacgcagggcggccaagagcgctccagcccgccccccgac
gtccctgagcgccgcctgtcggccaccccaccgggtcgcccagcccccatggacgggggc
gctagcccccagttcgacctggacgtgttcatctcccgagctctgaagctctgcaccaag
cctgaggacctgccggacaacaaactgggcgacctcaacggcgcgtgcatctccgagcac
cctggcgatctcgtgcagaccgaggccttctccaaagaaaggtggtaa

DBGET integrated database retrieval system