KEGG   Sus scrofa (pig): 100523504Help
Entry
100523504         CDS       T01009                                 

Definition
glutamate receptor ionotropic, kainate 4-like
Orthology
K05204  
glutamate receptor, ionotropic kainate 4
Organism
ssc  Sus scrofa (pig)
Pathway
Neuroactive ligand-receptor interaction
Glutamatergic synapse
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100523504
 Organismal Systems
  Nervous system
   04724 Glutamatergic synapse
    100523504
Ion channels [BR:ssc04040]
 Glutamate-gated cation channels
  Glutamate (ionotropic), non-NMDA
   100523504
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
9
AA seq 680 aa AA seqDB search
MEALLEQDYEGAFKGSPRFLQVSSPPQVARCFGVAFTQHLTLTQPQLLEWSWSQPISLCP
YVMQNRAGSRQSAHVCHLDPLSANLSPIHTPPAHPSASLPPISSSHPVSPPKIGQWHVAD
GLSMDSRLYASNISDSLFNTTLVVTTILENPYLMLKGNHQEMEGNDRYEGFCVDMLKELA
EILRFNYKIRLVGDGVYGVPEANGTWTGMVGELIARKADLAVAGLTITAEREKVIDFSKP
FMTLGISILYRVHMGRRPGYFSFLDPFSPGVWLFMLLAYLAVSCVLFLVARLTPYEWYSP
HPCAQGRCNLLVNQYSLGNSLWFPVGGFMQQGSTIAPRALSTRCVSGVWWAFTLIIISSY
TANLAAFLTVQRMDVPIESVDDLADQTAIEYGTIHGGSSMTFFQNSRYQTYQRMWNYMYS
KQPSVFVKSTEEGIARVLNSNYAFLLESTMNEYYRQRNCNLTQIGGLLDTKGYGIGMPVG
SVFRDEFDLAILQLQENNRLEILKRKWWEGGKCPKEEDHRAKGLGMENIGGIFVVLICGL
IVAIFMAMLEFLWTLRHSEATEVSVCQEMVTELRSIILCQDSVHPRRRRSGLPPPRPPIP
EERRPRGTVTLSNGKLCGAGEPDQLAQRLAQEAALVARGCTHIRVCPECRRFQGLRARPS
PARSEESLEWEKTTNSSEPE
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atggaagctttgctggagcaggactatgagggggcatttaaaggaagcccccgtttcctt
caagtgtcctcccctccccaagtggccaggtgcttcggggtagcttttacccagcacctg
accctgacccaaccccagctcctggagtggtcctggagtcagcccatctccctctgccca
tatgtgatgcagaacagggcaggttcccggcaatcagcccacgtctgtcatctggatccc
ctctctgccaacctgtcccccatccacactcctccagctcatccctcggcctccttgccg
ccaatctcctcctctcacccagtttcacctccaaagattggccagtggcacgtggcagac
ggcctgagcatggacagccgcctctacgcctccaacatctccgacagtctcttcaacacc
accctggtcgtcaccaccatcctggaaaacccgtatttaatgctgaaggggaaccaccag
gagatggaaggcaatgaccgctatgagggcttctgtgtggacatgcttaaggagctggca
gagatcctccggttcaactacaagatccgcctggtcggggacggcgtgtacggcgtgcct
gaggccaatggcacctggacgggaatggtcggggagctgatcgctcggaaagcagatctg
gccgtggcaggcctcaccatcacggctgaacgggagaaggtgattgatttctcaaagcca
ttcatgactctgggaattagcattctttaccgagttcatatgggacgcagacctggctat
ttctccttcctggacccattttctccgggcgtctggctcttcatgcttctagcctatctg
gccgtcagctgcgtcctcttcctggtggctcggttgaccccctatgagtggtacagcccc
cacccatgtgcccagggccggtgcaacctcctggtgaatcagtactcgctgggcaacagc
ctctggtttccggtcgggggcttcatgcagcagggctccaccattgcccctcgcgcctta
tccacccgctgtgtcagtggcgtctggtgggcattcacgctgatcatcatctcatcctac
acggccaacctggcagccttcctgaccgtgcagcgcatggatgtgcccattgagtcagtg
gacgacctggctgaccagaccgccattgaatatggcacaattcacggaggctccagcatg
accttcttccaaaattcccgctatcagacctaccagcgcatgtggaattacatgtactcc
aagcagcccagtgtgtttgtgaagagcaccgaggaggggatcgccagggtgttgaactcc
aactacgccttcctgctggagtccaccatgaacgagtactatcggcagcgaaactgcaac
ctcactcagattgggggcctgctggacaccaagggctatgggattggcatgccagtcggc
tctgtcttccgcgacgagtttgatctggccattctccagctgcaggagaacaaccgcctg
gaaattctgaagcgcaagtggtgggaagggggcaagtgcccgaaggaggaggatcacaga
gccaaaggactgggcatggagaatattggtggaatctttgtggttcttatttgtggctta
atcgtggccatttttatggctatgttggagtttttgtggaccctccggcattctgaagcg
actgaggtgtccgtctgccaggagatggtgaccgagctgcgcagcatcatcctgtgtcag
gacagtgtccacccgcgccggcggcgctccggcctgcctccgccccggccccccatcccg
gaggagcgccggccccggggcaccgtgacgctcagcaacggcaagctgtgcggggccggg
gagcccgaccagctggcgcagagactggcccaagaggccgccctggtggcccgcggctgc
acgcacatccgcgtgtgccctgagtgccgccgtttccagggcctgcgggctcggccgtcg
cccgcgcgcagcgaggagagcctggagtgggagaagaccaccaacagcagcgaacccgag
tag

DBGET integrated database retrieval system