KEGG   Sus scrofa (pig): 100523576Help
Entry
100523576         CDS       T01009                                 

Gene name
KAT6A
Definition
(RefSeq) LOW QUALITY PROTEIN: histone acetyltransferase KAT6A
  KO
K11305  
histone acetyltransferase MYST3 [EC:2.3.1.48]
Organism
ssc  Sus scrofa (pig)
Pathway
Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Cellular Processes
  Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100523576 (KAT6A)
Enzymes [BR:ssc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100523576 (KAT6A)
Chromosome [BR:ssc03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    100523576 (KAT6A)
   HAT complexes
    MOZ/MORF complex
     100523576 (KAT6A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
17
AA seq 1997 aa AA seqDB search
MVKLANPLYTEWILEAIKKVKKQKQRPSEERICNAVSSSHGLDRKTVLEQLELSVKDGTI
LKVSNKGLNSYKDPDNPGRIALPKPRNHGKLDNKQNVDWNKLIKRAVEGLAESGGSTLKS
IERFLKGQKDVSASFGGGAASGFHQQLRLAIKRAVGHGRLLKDGPLYRLNTKATSVDGKE
SCESLSSLPPVSLLPHEKDKPVAEPIPICSFCLGTKEQNREKKPEELISCADCGNSGHPS
CLKFSPELTVRVKALRWQCIECKTCSSCRDQGKNADNMLFCDSCDRGFHMECCDPPLTRM
PKGMWICQICRPRKKGRKLLQKKAAQIKRRYANPIGRPKNRLKKQNTVSKCPFSKVRTGP
GRGRKRKITLSSQSASSSEEGYLEQIDGLDFCRDGSIPLKFNKKTKGLIDGLTKFFTPSP
DGRKPRGEVVDYSEQYRIRKKGSRKPSTSDWPTDNQDGWDGKQESEERLFGSQEIMTEKD
MELFRDIQEQALQKVGVTGPPDPQVRCPSVIEFGKYEIHTWYSSPYPQEYSRLPKLYLCE
FCLKYMKSRTILQQHMKKCGWFHPPANEIYRKSDISVFEVDGNVSTIYCQNLCLLAKLFL
DHKTLYYDVEPFLFYVLTQNDVKGCHLVGYFSKEKHCQQKYNVSCIMILPQYQRKGYGRF
LIDFSYLLSKREGQAGSPEKPLSDLGRLSYMAYWKSVILECLYHQNDKQISIKKLSKLTG
ICPQDITSTLHHLRMLDFRSDQFVIIRREKLIQDHMAKLQLNLRPVDVDPECLRWTPVIV
SNSVVSEEEEEEEEEEEQEEPQSQEGELEPSVVGKSASCENKEQDSYSSVESEKKPEVTA
PASSTRLNKQVLPRDSLPANNQPPRRGRWGRRNRKTQEHFGDKDSKLLLEEASAPQEQYG
DCEEKSETSQEQYMEGEEQSVASQEQPSQDGKPDAPKRRPSEGLELWRGPLKKSPEPLKC
GLPEGHDRLPRHFGEGRYGDADGARALMRECSESSEEEEPESPRSSXPPVLTKPTLKRKK
PILHRRRRVRKRKHHNSSVVTETISETTEVLDEPFEDSDSERPMPRLEPTFEIDEEEEED
ENELFSRGYFRRLSSQDVLRCRSASKRKSKDEDDDEESDDVDDTPILKPVSLLRKCDVKD
SPLEPDTSTPMKKKKGWPKGKSRKPVHWKKRPGRKPGLKLSREMVPVSAQECVVEPVVPL
PKPGRKSKIQENEETVEPKDDLPLTEERKEEEELPAEAEDGEDGEEEDTASSGVRAGSPV
DSSSPEAEAKEPEAGEEEEKPRVPAEQRPVVEEPRELERREQEEEEDAAAETNQSEDHDA
DDEDDGHPESSKKEEPEGQPAQEDVTEEPGSQGSFLDPNVQSSRENPKEKDDTEPESEEE
QTSQEASVLSEHMPGSEDDHEEESHSKEELMELKGEEEIAHSELDLETVQAVQSLTQEES
SEHEGAYPDCEETLAACQTLQSYTQADEDPQMSLVEDCHASEHNSPLSSVQSHPSQSVRS
VSSPSVPALESSYTQISPEQGSLSAPSMQNMETSPMMDVPSVSDHSQQVVDSGFSDLGSI
ESTTENYENPSSYDSTMGGSICGNSSSQSSCSYGGLASSSSLTQSSCVGTQQMAGMGGSC
SLMPQSGVQPAANCSIKSPQSCVVERPPXNQQPPPPQPPPQPPPPPPAPQPPPQPPPPQP
QQPPPPXPPQQQPPLSQCSMNNSFTPAPMIMEIPESGSAGNISIYERIPGDFGAGSYSQP
SATFSLAKLQQLTNTIMDPHAMPYSHSPAVTSYATSVSLSNTGLAQLAPSHPLAGTPQAQ
ATMTPPPNLASTTMNLTSPLLQCNMSATNIGIPHTQRLQGQMPVKGHISIRSKSAPLPSA
AAHQQQLYGRSPPAVAMQAGPRALAVQRGMNMGVNLMPTPAYNVNSMNMNTLNAMNSYRM
TQPMMNSSYHSNPAYMNQTAQYPMQMQMGMMGSQAYTQQPMQPNPHGNMMYTGPSHHSYM
NAAGVPKQSLNGPYMRR
NT seq 5994 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaactcgctaacccgctgtatacggagtggattttggaggccatcaaaaaagtg
aagaagcaaaaacagcgtccttcagaagaaaggatatgcaatgcagtgtcttcatcccat
ggcttggatcgtaaaactgttttagaacaattggagttgagtgtcaaagatggaacaatt
ttgaaagtctcaaataaaggactcaattcctataaagatcctgataatcctgggcgaata
gcacttcctaaacctcgaaaccatggaaaattggataataaacaaaacgtagactggaat
aaactgatcaagcgggcagttgagggcttggcggagtccggtggctcaactttgaaaagc
atcgaacgttttttgaaaggtcagaaggatgtgtctgcatcatttggaggcggtgctgcc
tctggctttcaccagcagttacgattggctattaaacgtgccgttggccacggcagactc
cttaaagatggacccctttatcggctcaacactaaagcaaccagtgtggatgggaaagag
agttgtgagtctctttcctctttacctccagtgtcactccttccacatgaaaaggataag
ccggttgctgaaccaatccccatctgtagtttctgtcttggtacaaaagaacaaaaccgg
gaaaagaagccagaggaactcatctcctgtgcagactgtggcaacagtggtcatccatcc
tgtttaaagttttcccccgaactaacggttagagtgaaggccttacggtggcagtgcatc
gagtgtaagacgtgcagctcctgtcgagatcagggcaaaaatgcggataacatgctcttc
tgtgattcctgtgaccggggttttcatatggagtgttgtgatccaccactcactcggatg
ccaaaaggcatgtggatatgtcaaatatgtcgacctaggaaaaaaggacggaaacttcta
cagaagaaggcggcacagataaaacggcgctatgctaatccaataggacgtccaaaaaac
aggttaaagaaacaaaacacggtgtcaaaatgtcccttcagcaaagttcgaacaggccct
ggaaggggtaggaaacgtaaaatcactctctccagccagtcagcatcgtcctcagaagaa
ggctatctagagcaaatagacggcttggacttctgcagagatggcagtatccccttgaag
ttcaataagaaaaccaaagggctcattgatggccttaccaaattctttaccccttcccct
gatgggcggaagcctcgaggggaggtggtagactactccgagcaatacagaatcaggaaa
aagggcagcagaaagccaagcacctcagattggcccacagacaatcaggatggctgggat
ggcaaacaagaaagtgaggaacggctttttgggagccaggaaatcatgactgagaaagat
atggagttatttcgtgatattcaagaacaagcactgcagaaagttggagtgactggtccc
cctgaccctcaagtccgctgtccctctgtcattgagtttgggaagtatgaaattcacacc
tggtactcttccccatatcctcaagaatactcaaggctgcctaaattgtatctctgtgaa
ttctgtctaaaatatatgaaaagtagaaccatcctgcagcagcacatgaagaaatgtggc
tggttccaccctcctgctaatgagatctacagaaagagtgatatttctgtttttgaggtt
gatgggaatgtgagtaccatttattgtcagaacctgtgtctcttggcaaagttgtttctt
gaccacaaaacactctattatgacgtggagccatttcttttttatgtactaacacagaat
gatgtcaagggctgccaccttgttgggtacttttctaaagaaaagcactgccaacagaaa
tataacgtttcctgtataatgattcttccccagtaccaacgcaagggctatggcaggttt
ctcatcgatttcagttatttgttatcaaagcgtgaaggccaagcagggtctccagagaaa
ccattatccgatctaggtcgtctttcctacatggcttattggaaaagtgtaatattggag
tgcctttatcaccaaaatgacaagcaaatcagcattaagaagctaagcaagctgactgga
atctgccctcaagacattacttccacactccaccacctgcggatgctggactttcggagt
gaccaatttgtgattatccgccgggaaaaacttatccaggatcacatggcaaagcttcag
ctgaatctgcggcccgtggacgtagatccagaatgtttgcgctggacacctgtcatagtc
tccaactctgtcgtctcagaggaggaagaggaggaggaggaggaggaggaacaggaggaa
cctcagagccaggagggggagctggagccgagtgtggtggggaagtctgcatcttgtgag
aacaaagaacaagattcttactcttcagtagaaagtgaaaagaaaccagaagttacagcc
ccagccagttccacacgtttgaacaaacaagtccttccccgtgacagtcttcctgccaat
aatcagccacctcggagaggccgctgggggaggagaaacagaaaaacccaggaacacttt
ggagataaggattccaaactactcttggaagaggcatcagctcctcaggaacaatatggc
gactgtgaggaaaaatcagaaacatcccaggaacagtacatggagggggaggagcagtca
gtggcctcgcaggagcagccaagccaggatgggaagccggatgctcccaagagaagaccc
agcgaggggcttgagctctggcgaggacccctgaagaagagccctgagcctctgaagtgt
gggctgccagaaggccatgaccggttgccccggcacttcggcgaggggcgctacggggat
gcggatggggcccgggccctgatgcgggaatgcagcgagagcagtgaggaggaggagcct
gagagccctcggtctagcntccccccagtcctcaccaagcccacgctgaagcggaagaaa
ccaattcttcaccgaagaaggcgagtccgaaagcgcaaacaccacaatagcagtgtggtc
acagagaccatttctgagaccacagaggtattagacgagccttttgaagactctgactcg
gaaaggccgatgccaaggttagaacccacatttgagattgacgaggaggaggaagaggat
gagaatgagctcttctctagagggtacttccgtcgcttgtcctcccaagatgttctcagg
tgtcgatctgcttctaagaggaagtcaaaagatgaagacgatgacgaagagtcagacgat
gttgatgacactcctatcctaaagccagtatctctattgagaaaatgtgatgtgaaggat
tctcctctggagccagatacatccacgcccatgaaaaagaagaaggggtggcccaaaggc
aagagccgcaagccagtgcactggaagaagagacctggtcgcaagccaggactcaagttg
agtcgggagatggtgcccgtgtctgctcaagaatgcgttgttgagcccgttgtccccctt
cctaaacctggacgtaaatccaaaattcaagagaatgaagaaactgttgaaccaaaagac
gacttgcctttaactgaggaaaggaaggaagaggaggagctgccggcggaagcagaggat
ggcgaggatggggaggaggaggacacagccagcagtggtgtccgggcggggtctccggtg
gacagcagcagccccgaggcagaagccaaggaacccgaggcaggggaggaggaggagaag
ccccgggtccccgcagagcagcggccggtggtggaggagccgcgggagctggagcggcgt
gagcaggaggaggaggaggacgcagctgctgagaccaaccagagcgaagaccacgatgca
gatgatgaagatgatgggcacccggagtcctcgaagaaggaggagccagaggggcagcca
gcccaggaggatgtcacagaggagcccggcagccagggctcttttttagatcctaatgta
cagagcagtagggagaacccaaaggagaaagatgacacagagccggagtcagaggaggag
cagacgtcccaggaggcgtccgtgctgtcggagcacatgccaggctctgaggacgatcac
gaggaagagtcgcactcgaaggaggagctgatggagttgaaaggggaggaagagattgct
cacagcgagctggatctggaaaccgtgcaggccgtgcagtctctgacccaggaggagagc
agcgagcacgagggggcctaccccgactgcgaggagaccctggcggcctgccagaccctg
cagagctacacccaggccgatgaggacccccagatgtccctggtggaagactgccacgcc
tcggagcacaacagcccgctgtcttccgtccagtcccaccccagtcagtcggtgcgctcg
gtcagcagccccagcgtgcccgccctggagagcagctacacccagatcagccccgagcag
gggtccctgtccgcaccttccatgcagaacatggagaccagccccatgatggacgtgcct
tccgtatctgaccactctcagcaggtggtggacagcggcttcagcgacctgggcagcatc
gagagcaccacggaaaactatgagaaccccagcagttacgactccacgatgggcggcagc
atctgtgggaacagctcctcccagagcagctgttcctacggcgggctggcgtcctccagc
agcctcacccagagcagctgcgtgggcacgcagcagatggccggcatgggcgggagctgc
agcctcatgccgcagagtggcgtccagcccgccgccaactgcagcatcaagtcgccccag
agctgtgtggtggagaggcccccangcaaccagcagccaccccctccccagccaccccca
cagccgccgccgcccccgccagcgccacagcctccgccccagcccccgcccccgcagccc
cagcagcccccgcccccanccccaccccagcagcagccccctctgtcccagtgcagcatg
aacaacagtttcactccggcacccatgatcatggagatcccagagtccggaagtgcgggg
aacatcagcatctacgagaggatcccgggggacttcggtgctggcagctactcccagccg
tcagccaccttcagtctcgccaagttgcagcagctgactaacaccattatggacccccat
gccatgccttatagccattctcctgctgtgacttcctatgcaaccagtgtttctctgtcc
aacacaggattggctcagctggctccgtctcaccctttagctgggactcctcaagcacaa
gccaccatgacgccgcccccgaacttggcctccaccaccatgaacctcacgtcccctctg
ctgcagtgcaacatgtctgccaccaacatcggcattccccacactcagaggttgcaagga
cagatgccagtcaaggggcacatctccatacgctccaagtccgcgcccctgccctccgca
gcggctcaccagcagcagctgtatggccgcagcccgcccgcagttgccatgcaggccggc
ccccgtgcattggccgttcagcgtggtatgaacatgggggttaacttaatgccaacccct
gcctataatgtcaattccatgaatatgaacaccttgaacgccatgaacagctatcgaatg
acacagcccatgatgaacagcagttaccatagtaaccctgcctacatgaaccagacagca
cagtatcctatgcagatgcagatggggatgatggggagccaggcctatacccagcagcct
atgcagccaaaccctcatggaaacatgatgtacactggcccctcccatcacagctacatg
aacgctgctggcgtgcccaagcagtcactcaacggaccttacatgagaagatga

DBGET integrated database retrieval system