KEGG   Sus scrofa (pig): 100523576Help
Entry
100523576         CDS       T01009                                 

Gene name
KAT6A
Definition
K(lysine) acetyltransferase 6A
Orthology
K11305  
histone acetyltransferase MYST3 [EC:2.3.1.48]
Organism
ssc  Sus scrofa (pig)
Pathway
Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Cellular Processes
  Cellular commiunity
   04550 Signaling pathways regulating pluripotency of stem cells
    100523576 (KAT6A)
Enzymes [BR:ssc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100523576 (KAT6A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
17
AA seq 1761 aa AA seqDB search
HPSCLKFSPELTVRVKALRWQCIECKTCSSCRDQGKNADNMLFCDSCDRGFHMECCDPPL
TRMPKGMWICQICRPRKKGRKLLQKKAAQIKRRYANPIGRPKNRLKKQNTVSKCPFSKVR
TGPGRGRKRKITLSSQSASSSEEGYLEQIDGLDFCRDGSIPLKFNKKTKGLIDGLTKFFT
PSPDGRKPRGEVVDYSEQYRIRKKGSRKPSTSDWPTDNQDGWDGKQESEERLFGSQEIMT
EKDMELFRDIQEQALQKVGVTGPPDPQVRCPSVIEFGKYEIHTWYSSPYPQEYSRLPKLY
LCEFCLKYMKSRTILQQHMKKCGWFHPPANEIYRKSDISVFEVDGNVSTIYCQNLCLLAK
LFLDHKTLYYDVEPFLFYVLTQNDVKGCHLVGYFSKEKHCQQKYNVSCIMILPQYQRKGY
GRFLIDFSYLLSKREGQAGSPEKPLSDLGRLSYMAYWKSVILECLYHQNDKQISIKKLSK
LTGICPQDITSTLHHLRMLDFRSDQFVIIRREKLIQDHMAKLQLNLRPVDVDPECLRWTP
VIVSNSVVSEEEEEEEEEEEQEEPQSQEGELEPSVVGKSASCENKEQDSYSSVESEKKPE
VTAPASSTRLNKQVLPRDSLPANNQPPRRGRWGRRNRKTQEHFGDKDSKLLLEEASAPQE
QYGDCEEKSETSQEQYMEGEEQSVASQEQPSQDGKPDAPKRRPSEGLELWRGPLKKSPEP
LKCGLPEGHDRLPRHFGEGRYGDADGARALMRECSESSEEEEPESPRSSSPPVLTKPTLK
RKKPILHRRRRVRKRKHHNSSVVTETISETTEVLDEPFEDSDSERPMPRLEPTFEIDEEE
EEDENELFSRGYFRRLSSQDVLRCRSASKRKSKDEDDDEESDDVDDTPILKPVSLLRKCD
VKDSPLEPDTSTPMKKKKGWPKGKSRKPVHWKKRPGRKPGLKLSREMVPVSAQECVVEPV
VPLPKPGRKSKIQENEETVEPKDDLPLTEERKEEEELPAEAEDGEDGEEEDTASSGVRAG
SPVDSSSPEAEAKEPEAGEEEEKPRVPAELRPVLEEPRELERRDAEDEEDAAAETIQSDD
HDVDDDDDGPPESSKMEELRGAAPRQDVSEEPGCQGSFLYPNVRSFREILMDGYYSEPEF
EEDIYFSXWSVLSYHMPGSEDYLDEDLHSXIRAEWIEGEEEIAHSESGSVKPLQDRCSSL
TQEESSEHEGAYPDCEETLAACQTLQSYTQADEDPQMSLVEDCHASEHNSPLSSVQSHPS
QSVRSVSSPSVPALESSYTQISPEQGSLSAPSMQNMETSPMMDVPSVSDHSQQVVDSGFS
DLGSIESTTENYENPSSYDSTMGGSICGNSSSQSSCSYGGLASSSSLTQSSCVGTQQMAG
MGGSCSLMPQSGVQPAANCSIKSPQSCVVERPPSNQQPPPPQPPPQPPPPPAAPQPPPQP
PPPQPQQPPPPPHPXQQPSVQCSMNNSFTPAPMIMEIPESGSAGNISIYERIPGDFGAGS
YSQPSATFSLAKLQQLTNTIMDPHAMPYSHSPAVTSYATSVSLSNTGLAQLAPSHPLAGT
PQAQATMTPPPNLASTTMNLTSPLLQCNMSATNIGIPHTQRLQGQMPVKGHISIRSKSAP
LPSAAAHQQQLYGRSPPAVAMQAGPRALAVQRGMNMGVNLMPTPAYNVNSMNMNTLNAMN
SYRMTQPMMNSSYHSNPAYMNQTAQYPMQMQMGMMGSQAYTQQPMQPNPHGNMMYTGPSH
HSYMNAAGVPKQSLNGPYMRR
NT seq 5288 nt NT seq  +upstreamnt  +downstreamnt
gtcatccatcctgtttaaagttttcccccgaactaacggttagagtgaaggccttacggt
ggcagtgcatcgagtgtaagacgtgcagctcctgtcgagatcagggcaaaaatgcggata
acatgctcttctgtgattcctgtgaccggggttttcatatggagtgttgtgatccaccac
tcactcggatgccaaaaggtatgtggatatgtcaaatatgtcgacctaggaaaaaaggac
ggaaacttctacagaagaaggcggcacagataaaacggcgctatgctaatccaataggac
gtccaaaaaacaggttaaagaaacaaaacacggtgtcaaaatgtcccttcagcaaagttc
gaacaggccctggaaggggtaggaaacgtaaaatcactctctccagccagtcagcatcgt
cctcagaagaaggctatctagagcaaatagacggcttggacttctgcagagatggcagta
tccccttgaagttcaataagaaaaccaaagggctcattgatggccttaccaaattcttta
ccccttcccctgacgggcggaagcctcgaggggaagtggtagactactccgagcaataca
gaatcaggaaaaagggcagcagaaagccaagcacctcagattggcccacagacaatcagg
atggctgggatggcaaacaagaaagtgaggaacggctttttgggagccaggaaatcatga
ctgagaaagatatggagttatttcgtgatattcaagaacaagcactgcagaaagttggag
tgactggtccccctgaccctcaagtccgctgtccctctgtcattgagtttgggaagtatg
aaattcacacctggtactcttccccatatcctcaagaatactcaaggctgcctaaattgt
atctctgtgaattctgtctaaaatatatgaaaagtagaaccatcctgcagcagcacatga
agaaatgtggctggttccaccctcctgctaatgagatctacagaaagagtgatatttctg
tttttgaggttgatgggaatgtgagtaccatttattgtcagaacctgtgtctcttggcaa
agttgtttcttgaccacaaaacactctattatgacgtggagccatttcttttttatgtac
taacacagaatgatgtcaagggctgccaccttgttgggtacttttctaaagaaaagcact
gccaacagaaatataacgtttcctgtataatgattcttccccagtaccaacgcaagggct
atggcaggtttctcatcgatttcagttatttgttatcaaagcgtgaaggccaagcagggt
ctccagagaaaccattatccgatctaggtcgtctttcctacatggcttattggaaaagtg
taatattggagtgcctttatcaccaaaatgacaagcaaatcagcattaagaagctaagca
agctgactggaatctgccctcaagacattacttccacactccaccacctgcggatgctgg
actttcggagtgaccaatttgtgattatccgccgggaaaaacttatccaggatcacatgg
caaagcttcagctgaatctgcggcccgtggacgtagatccagaatgtttgcgctggacac
ctgtcatagtctccaactctgtcgtctcagaggaggaagaggaggaggaggaggaggagg
aacaggaggaacctcagagccaggagggggagctggagccgagtgtggtggggaagtctg
catcttgtgagaacaaagaacaagattcttactcttcagtagaaagtgaaaagaaaccag
aagttacagccccagccagttccacacgtttgaacaaacaagtccttccccgtgacagtc
ttcctgccaataatcagccacctcggagaggccgctgggggaggagaaacagaaaaaccc
aggaacactttggagataaggattccaaactactcttggaagaggcatcagctcctcagg
aacaatatggcgactgtgaggaaaaatcagaaacatcccaggaacagtacatggaggggg
aggagcagtcagtggcctcgcaggagcagccaagccaggatgggaagccggatgctccca
agagaagacccagcgaggggcttgagctctggcgaggacccctgaagaagagccctgagc
ctctgaagtgtgggctgccagaaggccatgaccggttgccccggcacttcggcgaggggc
gctacggggatgcggatggggcccgggccctgatgcgggaatgcagcgagagcagtgagg
aggaggagcctgagagccctcggtctagctccccgccagtcctcaccaagcccacgctga
agcggaagaaaccaattcttcaccgaagaaggcgagtccgaaagcgcaaacaccacaata
gcagtgtggtcacagagaccatttctgagaccacagaggtattagacgagccttttgaag
actctgactcggaaaggccgatgccaaggttagaacccacatttgagattgacgaggagg
aggaagaggatgagaatgagctcttctctagagggtacttccgtcgcttgtcctcccaag
atgttctcaggtgtcgatctgcttctaagaggaagtcaaaagatgaagacgatgacgaag
agtcagacgatgttgatgacactcctatcctaaagccagtatctctattgagaaaatgtg
atgtgaaggattctcctctggagccagatacatccacgcccatgaaaaagaagaaggggt
ggcccaaaggcaagagccgcaagccagtgcactggaagaagagacctggtcgcaagccgg
gactcaagttgagtcgggagatggtgcccgtgtctgctcaagaatgcgttgttgagcccg
ttgtcccccttcctaaacctggacgtaaatccaaaattcaagagaatgaagaaactgttg
aaccaaaagacgacttgcctttaactgaggaaaggaaggaagaggaggagctgccggcgg
aagcagaggatggcgaggatggggaggaggaggacacagccagcagtggtgtccgggcgg
ggtctccggtggacagcagcagccccgaggcagaagccaaggaacccgaggcaggggagg
aggaggagaagccccgggtccccgcagagcttcggccggtgttggaggagccgcgggagc
tggagcgtcgtgatgctgaggatgaggaggacgcagctgctgagaccatccagagcgatg
accacgatgttgatgatgacgatgatgggcccccggagtcctcgaagatggaggagctcc
gaggggcagcccccaggcaggatgtctcagaggagcccggctgccagggctcttttttat
atcctaatgtacggagctttagggagatcctgatggacgggtattactctgagcctgagt
ttgaggaggatatttacttctcatgatggtccgtgctgtcttatcacatgccaggatctg
aggactatcttgatgaagatttgcactcttagatacgagctgaatggattgaaggggagg
aagagattgctcacagcgagtctggatctgtgaaaccgctgcaggaccgttgcagttctc
tgacccaggaggagagcagcgagcacgagggggcctaccccgactgcgaggagaccctgg
cggcctgccagaccctgcagagctacacccaggccgatgaggacccccagatgtccctgg
tggaagactgccacgcctcggagcacaacagcccgctgtcttccgtccagtcccacccca
gtcagtcggtgcgctcggtcagcagccccagcgtgcccgccctggagagcagctacaccc
agatcagccccgagcaggggtccctgtccgcaccttccatgcagaacatggagaccagcc
ccatgatggacgtgccttccgtatctgaccactctcagcaggtggtggacagcggcttca
gcgacctgggcagcatcgagagcaccacggagaactatgagaaccccagcagttacgact
ccacgatgggcggcagcatctgtgggaacagctcctcccagagcagctgttcctacggcg
ggctggcgtcctccagcagcctcacccagagcagctgcgtgggcacgcagcagatggccg
gcatgggcgggagctgcagcctcatgccgcagagtggcgtccagcccgccgccaactgca
gcatcaagtcgccccagagctgtgtggtggagaggccccccagcaaccagcagccacccc
ctccccagccacccccacagccgccgccgcccccggcagcgccacagcctccgccccagc
ccccgcccccgcagccccagcagcccccgcccccgccccacccanngcagcagccctctg
tccagtgcagcatgaacaacagtttcactccggcacccatgatcatggagatcccagagt
ccggaagtgcggggaacatcagcatctacgagaggatcccgggggacttcggtgctggca
gctactcccagccgtcagccaccttcagtctcgccaagttgcagcagctgactaacacca
ttatggacccccatgccatgccttatagccattctcctgctgtgacttcctatgcaacca
gtgtttctctgtccaacacaggattggctcagctggctccgtctcaccctttagctggga
ctcctcaagcacaagccaccatgacgccgcccccgaacttggcctccaccaccatgaacc
tcacgtcccctctgctgcagtgcaacatgtctgccaccaacatcggcattccccacactc
agaggttgcaaggacagatgccagtcaaggggcacatctccatacgctccaagtccgcgc
ccctgccctccgcagcggctcaccagcagcagctgtatggccgcagcccgcccgcagttg
ccatgcaggccggcccccgtgcattggccgttcagcgtggtatgaacatgggggttaact
taatgccaacccctgcctataatgtcaattccatgaatatgaacaccttgaacgccatga
acagctatcgaatgacacagcccatgatgaacagcagttaccatagtaaccctgcctaca
tgaaccagacagcacagtatcctatgcagatgcagatggggatgatggggagccaggcct
atacccagcagcctatgcagccaaaccctcatggaaacatgatgtacactggcccctccc
atcacagctacatgaacgctgctggcgtgcccaagcagtcactcaacggaccttacatga
gaagatga

DBGET integrated database retrieval system