KEGG   Sus scrofa (pig): 100523701Help
Entry
100523701         CDS       T01009                                 

Gene name
AOX1
Definition
(RefSeq) aldehyde oxidase 1 (EC:1.2.3.1)
  KO
K00157  
aldehyde oxidase [EC:1.2.3.1]
Organism
ssc  Sus scrofa (pig)
Pathway
Valine, leucine and isoleucine degradation
Tyrosine metabolism
Tryptophan metabolism
Vitamin B6 metabolism
Nicotinate and nicotinamide metabolism
Retinol metabolism
Drug metabolism - cytochrome P450
Metabolic pathways
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100523701 (AOX1)
   00350 Tyrosine metabolism
    100523701 (AOX1)
   00380 Tryptophan metabolism
    100523701 (AOX1)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    100523701 (AOX1)
   00760 Nicotinate and nicotinamide metabolism
    100523701 (AOX1)
   00830 Retinol metabolism
    100523701 (AOX1)
  Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    100523701 (AOX1)
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    100523701 (AOX1)
Enzymes [BR:ssc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.3  With oxygen as acceptor
    1.2.3.1  aldehyde oxidase
     100523701 (AOX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
15
AA seq 1338 aa AA seqDB search
MDGAAELLFYVNGRKVIEKNVNPETMLLPYLRKKLRLTGTKYGCGGGGCGACTVMISRYN
PITKRIRHYPANACLIPICSLYGAAVTTVEGIGSTRTRIHPVQERIAKCHGTQCGFCTPG
MVMSIYTLLRNHPEPTLSQLTEALGGNLCRCTGYRPIIDACKTFCKTSGCCQGKENEVCC
LDQGINGLPEFEEGNETSHKLFSEEEFLPLDPTQELIFPPELVTMAEKQPQRTRIFGGDR
MTWISPVTLKELLEAKVKYPQAPVVMGNTSVGPDVKFKGIFHPVVISPDSIEEMSIVNYT
DNGLTLGAALSLAQVKDILAKVIRKLPEEKTQTFHALWKHLGTLAGAQIRNMSSLGGHIV
SRHLDSDLNPLLAVGNCTLNLQSKEGKRQIPLNEQFLKKCPSASLKPEEILISVNIPYSR
KWEFVSAFRQAQRQQNALAMVNSGMRVFFGEGDGVIRELAIAYGGVGPTTICAKNSCQEL
IGRPWNEEMLDAACRLILDEVSLPGSAPGGRVEFRRTLIISFLFKFYLKVSQILKMRDPA
RYPSLADKHASALEDLHSRHPWITLKYQNANPKQLPQDPIGHPVMHLSGIKHATGEAVYC
DDMPTVDRELFLTFVTSSRAHAKIVSIDLSEALSLPGVVDIVTEEHLHGVNSFCLLTKPE
KLLSTDEVFCVGQLVCAVIADSEVQAKRAAQRVKIIYRDLEPLILTIEEAIQHKSFFEQE
KKLEYGNVDEAFKMVDQVLEGEIHLGGQEHFYMETQSMLVVPKGEDQEMDVYVSTQYPKY
IQDIVAWILKIPANKVMCHVKRVGGAFGGKVIKTGIMAAITAFAANKHGRAVRCILERGE
DMLITGGRHPYLGKYKVGFMNDGRILALDMEHYSNGGASLDESLFVVEMGLLKMENAYKF
PNLRCRAWACRTNLPSNTALRGFGFPQTGLITESCIMEVAAKCGLSPEKVRTINMYKEID
QTPYRQEIDAKNLIQCWKECMAMSSYALRRTAVEKFNSENYWKKKGLAVVPLKYPVGTGS
LAMGQAAALVHIYLDGSVLVTHGGIEMGQGVHTKMLQVASRELRMPLSNIHLRGTSTETI
PNANISGGSVVADLNGLAVKDACQTLLKRLEPIISKNPGGTWKDWAQAAFDESISLSATG
YFRGYESNMNWETGEGHPFEYFVYGAACSEVEIDCLTGAHKNIRTDIVMDVGYSINPALD
IGQIEGAFIQGMGLYTIEELNYSPQGVLYSRGPSQYKIPAICDVPAELHISFLPPSQNSN
TLYSSKGLGESGMFLGCSVFFAIHDAINAARQERGLSGPLKLNSPLTPEKIRMACEDKFT
EMIPRDEPGSYVPWSVPI
NT seq 4017 nt NT seq  +upstreamnt  +downstreamnt
atggacggggcggcggagctgctgttctacgttaacggccgcaaggtgatagaaaaaaat
gtcaatcctgaaacaatgctgttaccatatttgaggaagaagctccgactcacaggaact
aaatatggctgtggagggggaggctgtggtgcctgcacggtgatgatatcacgatataac
cccattaccaagaggataagacattatccggctaacgcctgtctgattcccatctgttcc
ctgtatggtgctgctgtcaccacagtagaaggcataggaagcaccaggaccaggattcat
cctgttcaggagaggattgccaagtgtcacggcacgcagtgtggcttctgcacccctggg
atggtgatgtccatctacacgctgctcaggaaccaccccgagcccaccctcagtcaatta
actgaagcccttggtggtaacctgtgccgttgcactggatacaggcccataattgatgca
tgcaagactttctgtaaaacttctggctgctgtcaaggtaaagaaaatgaggtttgctgt
ttggatcaaggaataaatggattaccagaatttgaggaaggaaatgagacaagtcacaaa
ctcttttcagaagaggagtttctgccattggatccaactcaggaattgatatttcctcct
gagctagtgacaatggctgagaaacaaccacaaaggaccaggatttttggtggtgatagg
atgacatggatttccccagtgaccctgaaggaacttctagaagccaaagtcaaatatccc
caggcccctgttgtcatggggaacacctctgtggggcctgacgtgaaatttaaaggcatc
tttcacccagttgtaatatctcctgacagcattgaagaaatgagtattgtaaactataca
gataatgggctgactttaggtgccgccctcagcctggctcaggtgaaggacatcctggct
aaggtgatccggaagctcccagaggagaagacccagacattccacgctctctggaagcat
ttgggaactctggctggagcccagatcaggaacatgtcttctttagggggccacatagtg
agcagacatctagattcagatctgaatcccctcctggccgtgggcaactgtactcttaat
ttgcaatcaaaagaaggaaaacgacagattcctttaaatgagcagtttctcaaaaagtgc
cccagtgccagtcttaagcctgaagaaatcttgatctcagtgaatatcccctattcaaga
aagtgggagtttgtgtcggccttccgacaagcccagcgacagcagaacgcgctagcgatg
gtcaattcgggaatgagagtgtttttcggagaaggagatggcgtcattagagagttagcc
atcgcgtatggaggagttggtccaaccaccatctgtgcaaagaattcctgccaggagctc
attggaaggccctggaatgaagagatgctggatgcagcttgcaggctgattctggacgaa
gtctccctcccaggctcagctccaggtgggagggtagaattccggaggactctcatcatc
agcttcctcttcaagttctacctgaaagtgtcacagattttgaagatgagggaccctgct
cgctatcctagccttgcagacaagcatgcgagtgctttggaggatcttcattccagacat
ccctggattacactgaagtaccagaatgcgaacccaaagcagcttcctcaagacccaatt
ggccatcccgtcatgcatctgtccggcattaagcacgccacgggcgaggccgtctactgt
gatgacatgcctaccgtggaccgggaactgttcctgaccttcgtaacaagttcaagagct
catgctaagattgtgtctattgatctgtcagaggctctcagcctgcctggtgtggtggac
atcgtgactgaggaacatcttcatggcgtcaactccttctgccttttaaccaaacctgag
aaacttctgtcgacagatgaggtgttttgcgtgggtcagcttgtctgtgctgtgattgcc
gattctgaggttcaggcaaagcgagctgcacagcgagtgaagatcatctaccgagatttg
gagcctctgatcctaaccatcgaggaagcaatacaacacaagtccttctttgagcaagaa
aagaaactggagtatgggaatgtggatgaagcatttaaaatggtggatcaagttcttgaa
ggtgaaatacacttgggcggtcaagaacatttttatatggaaacccaaagcatgcttgtt
gttcccaaaggagaggatcaagaaatggatgtctacgtgtccacacagtatcccaaatac
atacaggacatagttgcttggatcttgaagattccagctaacaaggtcatgtgtcacgta
aagcgtgttggcggggctttcggggggaaggtgataaaaactggcatcatggcagccatc
accgcctttgctgcaaacaagcacggtcgtgcagttcgctgcattctagagcgaggagaa
gacatgttaataactggaggccgccacccttaccttggaaagtataaagttggattcatg
aacgatggcagaatcttggccctggatatggagcattatagtaatggaggcgcctccctg
gatgagtcattatttgtcgtggagatgggacttctgaaaatggaaaatgcttacaagttt
cccaacctgcgctgccgggcatgggcctgcagaaccaaccttccatccaacacagccttg
cgagggtttggctttcctcagacagggcttatcactgagtcctgtatcatggaagttgca
gccaaatgtgggttgtctcctgagaaggttcgaacaataaacatgtacaaggaaattgat
cagacaccctacagacaagagattgatgccaagaacctgatccagtgttggaaagaatgt
atggccatgtcttcctatgccctaaggagaaccgctgtggaaaaattcaactcagagaat
tactggaagaaaaaggggctggccgtggtccccctgaagtatcctgtcggcaccggatca
cttgctatgggtcaggctgctgccctggttcacatttatcttgatggatctgtgctggtg
actcacggtggaattgaaatggggcagggggtccacacgaaaatgcttcaggtggccagt
cgtgagttgaggatgccattgtccaacatccacctgcgtggaacaagcacagaaaccatc
cctaatgccaatatctctggagggtccgtggtggccgacctcaacgggttggctgtaaag
gatgcttgccagactcttctaaaacgccttgaacccatcatcagcaagaatcctggtggc
acttggaaagactgggcacaggctgcttttgatgaaagcattagtctttcagctactgga
tacttcaggggttatgagtcgaacatgaactgggaaaccggtgaaggccatcctttcgaa
tactttgtttatggagctgcctgttccgaagttgaaatagactgcctgacaggtgctcat
aagaacatcagaacagacattgtcatggatgttggctacagtataaatccagcccttgac
attggccagatcgaaggtgcatttattcaaggcatgggactttacacaatagaggaactg
aattattctcctcagggtgtcctgtacagtcggggccccagccagtataaaatccctgcc
atctgtgatgtgcccgcggagctgcacatttccttcttgcctccgtctcaaaactcaaat
accctgtactcgtctaagggtctgggagagtctgggatgttcctggggtgttcagtgttt
ttcgccatccatgacgcaataaatgcagcgcgacaggagagaggcctgtctggaccttta
aagctcaatagtccactgaccccggagaagattagaatggcctgtgaagacaaattcaca
gaaatgattccaagagatgaacctgggtcctatgttccttggagtgtacccatatga

DBGET integrated database retrieval system