KEGG   Sus scrofa (pig): 100523701Help
Entry
100523701         CDS       T01009                                 

Definition
aldehyde oxidase-like
Orthology
K00157  
aldehyde oxidase [EC:1.2.3.1]
Organism
ssc  Sus scrofa (pig)
Pathway
Valine, leucine and isoleucine degradation
Tyrosine metabolism
Tryptophan metabolism
Vitamin B6 metabolism
Nicotinate and nicotinamide metabolism
Retinol metabolism
Drug metabolism - cytochrome P450
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100523701
   00350 Tyrosine metabolism
    100523701
   00380 Tryptophan metabolism
    100523701
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    100523701
   00760 Nicotinate and nicotinamide metabolism
    100523701
   00830 Retinol metabolism
    100523701
  Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    100523701
Enzymes [BR:ssc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.3  With oxygen as acceptor
    1.2.3.1  aldehyde oxidase
     100523701
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
15
AA seq 1309 aa AA seqDB search
MDGAAELLFYVNGRKVIEKNVNPETMLLPYLRKKLRLTGTKYGCGGGGCGACTVMISRYN
PITKRIRHYPANACLIPICSLYGAAVTTVEGIGSTRTRIHPVQERIAKCHGTQCGFCTPG
MVMSIYTLLRNHPEPTLSQLTEALGGNLCRCTGYRPIIDACKTFCKTSGCCQGKENEVCC
LDQGINGLPEFEEGNETSHKLFSEEEFLPLDPTQELIFPPELVTMAEKQPQRTRIFGGDR
MTWISPVTLKELLEAKVKYPQAPVVMGNTSVGPDVKFKGIFHPVVISPDSIEEMSIVNYT
DNGLTLGAALSLAQVKDILAKVIRKLPEEKTQTFHALWKHLGTLAGAQIRNMSSLGGHIV
SRHLDSDLNPLLAVGNCTLNLQSKEGKRQIPLNEQFLKKCPSASLKPEEILISVNIPYSR
KWEFVSAFRQAQRQQNALAMVNSGMRVFFGEGDGVIRELAIAYGGVGPTTICAKNSCQEL
IGRPWNEEMLDAACRLILDEVSLPGSAPGGRVEFRRTLIISFLFKFYLKVSQILKMRDPA
RYPSLADKHASALEDLHSRHPWITLKYQNANPKQLPQDPIGHPVMHLSGIKHATGEAVYC
DDMPAVDRELFLTFVTSSRAHAKIVSIDLSEALSLPGVVDIVTEEHLHGVNSFCLLTKPE
KLLSTDEVFCVGQLVCAVIADSEVQAKRAAQRVKIIYRDLEPLILTIEEAIQHKSFFEQE
KKLEYGNVDEAFKMVDQVLEGEIHLGGQEHFYMETQSMLVVPKGEDQEMDVYVSTQYPKY
IQDIVAWILKIPANKVMCHVKRVGGAFGGKVIKTGIMAAITAFAANKVGFMNDGRILALD
MEHYSNGGASLDESLFVVEMGLLKMENAYKFPNLRCRAWACRTNLPSNTALRGFGFPQTG
LITESCIMEVAAKCGLSPEKVRTINMYKEIDQTPYRQEIDAKNLIQCWKECMAMSSYALR
RTAVEKFNSENYWKKKGLAVVPLKYPVGTGSLAMGQAAALVHIYLDGSVLVTHGGIEMGQ
GVHTKMLQVASRELRMPLSNIHLRGTSTETIPNANISGGSVVADLNGLAVKDACQTLLKR
LEPIISKNPGGTWKDWAQAAFDESISLSATGYFRGYESNMNWETGEGHPFEYFVYGAACS
EVEIDCLTGAHKNIRTDIVMDVGYSINPALDIGQIEGAFIQGMGLYTIEELNYSPQGVLY
SRGPSQYKIPAICDVPAELHISFLPPSQNSNTLYSSKGLGESGMFLGCSVFFAIHDAINA
ARQERGLSGPLKLNSPLTPEKIRMACEDKFTEMIPRDEPGSYVPWSVPI
NT seq 3930 nt NT seq  +upstreamnt  +downstreamnt
atggacggggcggcggagctgctgttctacgttaacggccgcaaggtgatagaaaaaaat
gtcaatcctgaaacaatgctgttaccatatttgaggaagaagctccgactcacaggaact
aaatatggctgtggagggggaggctgtggtgcctgcacggtgatgatatcacgatataac
cccattaccaagaggataagacattatccggctaacgcctgtctgattcccatctgttcc
ctgtatggtgctgctgtcaccacagtagaaggcataggaagcaccaggaccaggattcat
cctgttcaggagaggattgccaagtgtcacggcacgcagtgtggcttctgcacccctggg
atggtgatgtccatctacacgctgctcaggaaccaccccgagcccaccctcagtcaatta
actgaagcccttggtggtaacctgtgccgttgcactggatacaggcccataattgatgca
tgcaagactttctgtaaaacttctggctgctgtcaaggtaaagaaaatgaggtttgctgt
ttggatcaaggaataaatggattaccagaatttgaggaaggaaatgagacaagtcacaaa
ctcttttcagaagaggagtttctgccattggatccaactcaggaattgatatttcctcct
gagctagtgacaatggctgagaaacaaccacaaaggaccaggatttttggtggtgatagg
atgacatggatttccccagtgaccctgaaggaacttctagaagccaaagtcaaatatccc
caggcccctgttgtcatggggaacacctctgtggggcctgacgtgaaatttaaaggcatc
tttcacccagttgtaatatctcctgacagcattgaagaaatgagtattgtaaactataca
gataatgggctgactttaggtgccgccctcagcctggctcaggtgaaggacatcctggct
aaggtgatccggaagctcccagaggagaagacccagacattccacgctctctggaagcat
ttgggaactctggctggagcccagatcaggaacatgtcttctttagggggccacatagtg
agcagacatctagattcagatctgaatcccctcctggccgtgggcaactgtactcttaat
ttgcaatcaaaagaaggaaaacgacagattcctttaaatgagcagtttctcaaaaagtgc
cccagtgccagtcttaagcctgaagaaatcttgatctcagtgaatatcccctattcaaga
aagtgggagtttgtgtcggccttccgacaagcccagcgacagcagaacgcgctagcgatg
gtcaattcgggaatgagagtgtttttcggagaaggagatggcgtcattagagagttagcc
atcgcgtatggaggagttggtccaaccaccatctgtgcaaagaattcctgccaggagctc
attggaaggccctggaatgaagagatgctggatgcagcttgcaggctgattctggacgaa
gtctccctcccaggctcagctccaggtgggagggtggaattccggaggactctcatcatc
agcttcctcttcaagttctacctgaaagtgtcacagattttgaagatgagggaccctgct
cgctatcctagccttgcagacaagcatgcgagtgctttggaggatcttcattccagacat
ccctggattacactgaagtaccagaatgcgaacccaaagcagcttcctcaagacccaatt
ggccatcccgtcatgcatctgtccggcattaagcacgccacgggcgaggccgtctactgt
gatgacatgcctgccgtggaccgggaactgttcctgaccttcgtaacaagttcaagagct
catgctaagattgtgtctattgatctgtcagaggctctcagcctgcctggtgtggtggac
atcgtgactgaggaacatcttcatggcgtcaactccttctgccttttaaccaaacctgag
aaacttctgtcgacagatgaggtgttttgcgtgggtcagcttgtctgtgctgtgattgcc
gattctgaggttcaggcaaagcgagctgcacagcgagtgaagatcatctaccgagatttg
gagcctctgatcctaaccatcgaggaagcaatacaacacaagtccttctttgagcaagaa
aagaaactggagtatgggaatgtggatgaagcatttaaaatggtggatcaagttcttgaa
ggtgaaatacacttgggcggtcaagaacatttttatatggaaacccaaagcatgcttgtt
gttcccaaaggagaggatcaagaaatggatgtctacgtgtccacacagtatcccaaatac
atacaggacatagttgcttggatcttgaagattccagctaacaaggtcatgtgtcacgta
aagcgtgttggcggggctttcggggggaaggtgataaaaactggcatcatggcagccatc
accgcctttgctgcaaacaaggttggattcatgaacgatggcagaatcttggccctggat
atggagcattatagtaatggaggcgcctccctggatgagtcattatttgtcgtggagatg
ggacttctgaaaatggaaaatgcttacaagtttcccaacctgcgctgccgggcatgggcc
tgcagaaccaaccttccatccaacacagccttgcgagggtttggctttcctcagacaggg
cttatcactgagtcctgtatcatggaagttgcagccaaatgtgggttgtctcctgagaag
gttcgaacaataaacatgtacaaggaaattgatcagacaccctacagacaagagattgat
gccaagaacctgatccagtgttggaaagaatgtatggccatgtcttcctatgccctaagg
agaaccgctgtggaaaaattcaactcagagaattactggaagaaaaaggggctggccgtg
gtccccctgaagtatcctgtcggcaccggatcacttgctatgggtcaggctgctgccctg
gttcacatttatcttgatggatctgtgctggtgactcacggtggaattgaaatggggcag
ggggtccacacgaaaatgcttcaggtggccagtcgtgagttgaggatgccattgtccaac
atccacctgcgtggaacaagcacagaaaccatccctaatgccaatatctctggagggtcc
gtggtggccgacctcaacgggttggctgtaaaggatgcttgccagactcttctaaaacgc
cttgaacccatcatcagcaagaatcctggtggcacttggaaagactgggcacaggctgct
tttgatgaaagcattagtctttcagctactggatacttcaggggttatgagtcgaacatg
aactgggaaaccggtgaaggccatcctttcgaatactttgtttatggagctgcctgttcc
gaagttgaaatagactgcctgacaggtgctcataagaacatcagaacagacattgtcatg
gatgttggctacagtataaatccagcccttgacattggccagatcgaaggtgcatttatt
caaggcatgggactttacacaatagaggaactgaattattctcctcagggtgtcctgtac
agtcggggccccagccagtataaaatccctgccatctgtgatgtgcccgcggagctgcac
atttccttcttgcctccgtctcaaaactcaaataccctgtactcgtctaagggtctggga
gagtctgggatgttcctggggtgttcagtgtttttcgccatccatgacgcaataaatgca
gcgcgacaggagagaggcctgtctggacctttaaagctcaatagtccactgaccccggag
aagattagaatggcctgtgaagacaaattcacagaaatgattccaagagatgaacctggg
tcctatgttccttggagtgtacccatatga

DBGET integrated database retrieval system