KEGG   Sus scrofa (pig): 100523928Help
Entry
100523928         CDS       T01009                                 

Definition
glycerol kinase-like
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ssc  Sus scrofa (pig)
Pathway
Glycerolipid metabolism
Metabolic pathways
PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    100523928
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    100523928
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     100523928
Exosome [BR:ssc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100523928
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
15
AA seq 553 aa AA seqDB search
MAASKKAVLGPLVGAVDQGTSSTRFLVFNSKTAELLSHHQVEIEQKFPKEGWVEQDPKEI
LQSVYECIEKTCEKLGQLNIDISNIKAIGVSNQRETTVVWDKLTGEPLYNAVVWLDLRTQ
STVANLSKIIPVNNNFVKTKTGLPLSTYFSAVKLRWLLDNVRKIQKAVEEDRALFGTIDS
WLIWSLTGGARGGVHCTDVTNASRTMLFNIHSLEWDKELCEFFEVPMKILPNVRSSSEIY
GLMKAGALEGVPISGCLGDQSAALVGQMCFQDGQAKNTYGTGCFLLCNTGHKCVFSEHGL
LTTVAYKLGRDKPVYYALEGSVAIAGAVVRWLRDNLGIIKTSEEIEKLAKEVGTSYGCYF
VPAFSGLYAPYWEPSARGIICGLTQFTNKCHIAFAALEAVCFQTREILDAMNRDCGIPLS
HLQVDGGMTNNKILMQLQADILYIPVVKPSMPETTALGAAMAAGAAEGVGVWSLKPEDLS
AVTMERFEPQINAKESEIRYSTWKKAVKKSMGWVTTQYPENGDPSIFSSLPLGFFIVSSM
VMLIGARYLSGVA
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atggcagcctcgaagaaagctgttttggggccgttggtgggagcagtggaccagggcacc
agctcgacgcgctttttggttttcaattcaaaaacagccgaactacttagtcatcatcaa
gtggaaatagaacaaaaatttccaaaagaagggtgggtggaacaagaccctaaggaaatc
ctgcagtccgtctatgagtgtatagagaaaacgtgtgagaaacttggtcagctcaatatt
gatatttccaacataaaagctattggtgtcagtaaccagagggaaaccactgtggtctgg
gacaagttaactggagaacccctctacaatgctgtggtgtggcttgatctaagaacccag
tctaccgttgcgaaccttagtaaaatcattccagtgaataataactttgtcaagaccaag
acaggccttccactcagcacgtacttcagtgcagtgaagcttcgttggctccttgataat
gtgagaaaaattcaaaaggcagttgaagaagatagagctctttttgggaccattgattcc
tggcttatttggagcttgacaggaggagccaggggaggtgttcattgtacagacgtaaca
aatgcaagtaggacgatgctattcaacattcattctttggaatgggataaagagctctgt
gaattttttgaagttccaatgaaaattctgccaaacgtccggagttcttctgagatctat
ggcctaatgaaagctggggccttggaaggcgtgccaatatctgggtgtttgggagaccag
tctgctgcattggtgggacagatgtgcttccaggatggacaggccaaaaacacgtatgga
acaggctgtttcttactatgtaatacaggccacaagtgtgtgttttctgaacatggcctt
ctgaccacagtggcttacaaacttggcagagacaaaccagtgtattatgcattagaaggc
tcagtagctatagctggtgctgttgttcgctggctaagagacaatcttggaattataaag
acctcagaggaaattgaaaaacttgctaaagaagtaggtacttcttatggctgttatttt
gtcccagccttttcagggctatatgcaccttactgggagcccagtgcaagagggatcatc
tgtgggctcactcaattcaccaataaatgccatattgcttttgctgcgttagaagctgtt
tgtttccaaacccgagagattttggatgccatgaaccgtgactgtggaattccactcagc
catttgcaggtagatgggggaatgaccaacaacaaaattcttatgcagctacaagcagac
attctgtatatcccagtagtgaagccctcaatgccagaaacaaccgccttgggagctgcc
atggcagcaggggctgcagaaggagttggcgtttggagtctcaaacctgaggatttatca
gctgtcacgatggagcggtttgaacctcagatcaatgctaaagaaagtgaaattcgttat
tccacatggaagaaagctgtgaagaagtccatgggttgggttacaactcagtatccagaa
aatggtgaccctagtatcttcagtagcctacccttgggcttttttatagtgagtagtatg
gtaatgttaattggagcaaggtacctctcaggcgtggcataa

DBGET integrated database retrieval system