KEGG   Sus scrofa (pig): 100523928Help
Entry
100523928         CDS       T01009                                 

Definition
glycerol kinase-like
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ssc  Sus scrofa (pig)
Pathway
Glycerolipid metabolism
Metabolic pathways
PPAR signaling pathway
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:ssc00561]
Organismal Systems; Endocrine system; PPAR signaling pathway [PATH:ssc03320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
15
AA seq 553 aa AA seqDB search
MAASKKAVLGPLVGAVDQGTSSTRFLVFNSKTAELLSHHQVEIEQKFPKEGWVEQDPKEI
LQSVYECIEKTCEKLGQLNIDISNIKAIGVSNQRETTVVWDKLTGEPLYNAVVWLDLRTQ
STVANLSKIIPVNNNFVKTKTGLPLSTYFSAVKLRWLLDNVRKIQKAVEEDRALFGTIDS
WLIWSLTGGARGGVHCTDVTNASRTMLFNIHSLEWDKELCEFFEVPMKILPNVRSSSEIY
GLMKAGALEGVPISGCLGDQSAALVGQMCFQDGQAKNTYGTGCFLLCNTGHKCVFSEHGL
LTTVAYKLGRDKPVYYALEGSVAIAGAVVRWLRDNLGIIKTSEEIEKLAKEVGTSYGCYF
VPAFSGLYAPYWEPSARGIICGLTQFTNKCHIAFAALEAVCFQTREILDAMNRDCGIPLS
HLQVDGGMTNNKILMQLQADILYIPVVKPSMPETTALGAAMAAGAAEGVGVWSLKPEDLS
AVTMERFEPQINAKESEIRYSTWKKAVKKSMGWVTTQYPENGDPSIFSSLPLGFFIVSSM
VMLIGARYLSGVA
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atggcagcctcgaagaaagctgttttggggccgttggtgggagcagtggaccagggcacc
agctcgacgcgctttttggttttcaattcaaaaacagccgaactacttagtcatcatcaa
gtggaaatagaacaaaaatttccaaaagaagggtgggtggaacaagaccctaaggaaatc
ctgcagtccgtctatgagtgtatagagaaaacgtgtgagaaacttggtcagctcaatatt
gatatttccaacataaaagctattggtgtcagtaaccagagggaaaccactgtggtctgg
gacaagttaactggagaacccctctacaatgctgtggtgtggcttgatctaagaacccag
tctaccgttgcgaaccttagtaaaatcattccagtgaataataactttgtcaagaccaag
acaggccttccactcagcacgtacttcagtgcagtgaagcttcgttggctccttgataat
gtgagaaaaattcaaaaggcagttgaagaagatagagctctttttgggaccattgattcc
tggcttatttggagcttgacaggaggagccaggggaggtgttcattgtacagacgtaaca
aatgcaagtaggacgatgctattcaacattcattctttggaatgggataaagagctctgt
gaattttttgaagttccaatgaaaattctgccaaacgtccggagttcttctgagatctat
ggcctaatgaaagctggggccttggaaggcgtgccaatatctgggtgtttgggagaccag
tctgctgcattggtgggacagatgtgcttccaggatggacaggccaaaaacacgtatgga
acaggctgtttcttactatgtaatacaggccacaagtgtgtgttttctgaacatggcctt
ctgaccacagtggcttacaaacttggcagagacaaaccagtgtattatgcattagaaggc
tcagtagctatagctggtgctgttgttcgctggctaagagacaatcttggaattataaag
acctcagaggaaattgaaaaacttgctaaagaagtaggtacttcttatggctgttatttt
gtcccagccttttcagggctatatgcaccttactgggagcccagtgcaagagggatcatc
tgtgggctcactcaattcaccaataaatgccatattgcttttgctgcgttagaagctgtt
tgtttccaaacccgagagattttggatgccatgaaccgtgactgtggaattccactcagc
catttgcaggtagatgggggaatgaccaacaacaaaattcttatgcagctacaagcagac
attctgtatatcccagtagtgaagccctcaatgccagaaacaaccgccttgggagctgcc
atggcagcaggggctgcagaaggagttggcgtttggagtctcaaacctgaggatttatca
gctgtcacgatggagcggtttgaacctcagatcaatgctaaagaaagtgaaattcgttat
tccacatggaagaaagctgtgaagaagtccatgggttgggttacaactcagtatccagaa
aatggtgaccctagtatcttcagtagcctacccttgggcttttttatagtgagtagtatg
gtaatgttaattggagcaaggtacctctcaggcgtggcataa

DBGET integrated database retrieval system