KEGG   Sus scrofa (pig): 100524254Help
Entry
100524254         CDS       T01009                                 

Definition
NADH-cytochrome b5 reductase 3-like
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
ssc  Sus scrofa (pig)
Pathway
Amino sugar and nucleotide sugar metabolism
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ssc00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Structure
PDB: 

Jmol
Position
5
AA seq 301 aa AA seqDB search
MGAQLSTLGHVVLSPVWFLYSLLMKLFQRSTPAITLENPDIKYPLRLIDKEVVNHDTRRF
RFALPSPQHVLGLPVGQHIYLSARIDGNLVIRPYTPVSSDDDKGFVDLVIKVYFKDTHPK
FPAGGKMSQYLESMKIGDTIEFRGPNGLLVYQGKGKFAIRPDKKSSPVIKTVKSVGMIAG
GTGITPMLQVIRAIMKDPDDHTVCHLLFANQTEKDILLRPELEELRNEHSARFKLWYTVD
RAPEAWDYSQGFVNEEMIRDHLPPPEEEPLVLMCGPPPMIQYACLPNLERVGHPKERCFA
F
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgggggcccagctgagcacgttgggccacgtggtcctgtccccagtctggttcctgtat
agcctgctcatgaagctgttccagcgttccaccccggccatcaccctcgagaacccagac
atcaagtatccgctgaggctcattgacaaggaggtcgtcaaccatgacacccggcggttc
cgctttgccctgccgtcgccccagcacgtcctgggcctccctgtgggccagcacatctac
ctctcggctcggattgatgggaacctggtcattcggccctacacgcccgtctccagtgat
gacgacaagggctttgtggacctggtcatcaaggtgtacttcaaagacacccaccccaag
tttcccgccggagggaagatgtcccagtacctggagagcatgaagatcggagacaccatc
gagttccggggccccaacgggctgctggtctaccagggcaaaggaaagtttgccatccgc
ccagacaagaaatccagtcccgtcatcaagacggtgaagtctgtgggcatgatcgcggga
ggaaccggcatcaccccaatgctgcaggtgatccgagccatcatgaaggacccggatgac
cacaccgtgtgccacctgctctttgccaaccagaccgagaaggacatcttgctgcggccc
gagctggaggaactgaggaacgaacattctgcgcgcttcaagctctggtacacggtggac
agagccccggaagcctgggactacagccagggcttcgtgaacgaggagatgatccgggac
caccttccgcccccggaggaggagccgctggtgctgatgtgcgggcccccgcccatgatc
cagtacgcctgcctgcccaacctggagcgcgtgggccaccccaaggagcgctgcttcgcc
ttctga

DBGET integrated database retrieval system