KEGG   Sus scrofa (pig): 100524254Help
Entry
100524254         CDS       T01009                                 

Definition
NADH-cytochrome b5 reductase 3-like
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
ssc  Sus scrofa (pig)
Pathway
Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    100524254
Enzymes [BR:ssc01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     100524254
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Structure
PDB: 

Jmol
Position
5
AA seq 301 aa AA seqDB search
MGAQLSTLGHVVLSPVWFLYSLLMKLFQRSTPAITLENPDIKYPLRLIDKEVVNHDTRRF
RFALPSPQHVLGLPVGQHIYLSARIDGNLVIRPYTPVSSDDDKGFVDLVIKVYFKDTHPK
FPAGGKMSQYLESMKIGDTIEFRGPNGLLVYQGKGKFAIRPDKKSSPVIKTVKSVGMIAG
GTGITPMLQVIRAIMKDPDDHTVCHLLFANQTEKDILLRPELEELRNEHSARFKLWYTVD
RAPEAWDYSQGFVNEEMIRDHLPPPEEEPLVLMCGPPPMIQYACLPNLERVGHPKERCFA
F
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgggggcccagctgagcacgttgggccacgtggtcctgtccccagtctggttcctgtat
agcctgctcatgaagctgttccagcgttccaccccggccatcaccctcgagaacccagac
atcaagtatccgctgaggctcattgacaaggaggtcgtcaaccatgacacccggcggttc
cgctttgccctgccgtcgccccagcacgtcctgggcctccctgtgggccagcacatctac
ctctcggctcggattgatgggaacctggtcattcggccctacacgcccgtctccagtgat
gacgacaagggctttgtggacctggtcatcaaggtgtacttcaaagacacccaccccaag
tttcccgccggagggaagatgtcccagtacctggagagcatgaagatcggagacaccatc
gagttccggggccccaacgggctgctggtctaccagggcaaaggaaagtttgccatccgc
ccagacaagaaatccagtcccgtcatcaagacggtgaagtctgtgggcatgatcgcggga
ggaaccggcatcaccccaatgctgcaggtgatccgagccatcatgaaggacccggatgac
cacaccgtgtgccacctgctctttgccaaccagaccgagaaggacatcttgctgcggccc
gagctggaggaactgaggaacgaacattctgcgcgcttcaagctctggtacacggtggac
agagccccggaagcctgggactacagccagggcttcgtgaacgaggagatgatccgggac
caccttccgcccccggaggaggagccgctggtgctgatgtgcgggcccccgcccatgatc
cagtacgcctgcctgcccaacctggagcgcgtgggccaccccaaggagcgctgcttcgcc
ttctga

DBGET integrated database retrieval system