KEGG   Sus scrofa (pig): 100524422Help
Entry
100524422         CDS       T01009                                 

Gene name
PTPN5
Definition
protein tyrosine phosphatase, non-receptor type 5 (striatum-enriched)
Orthology
K18018  
tyrosine-protein phosphatase non-receptor type 5 [EC:3.1.3.48]
Organism
ssc  Sus scrofa (pig)
Pathway
MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100524422 (PTPN5)
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     100524422 (PTPN5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
2
AA seq 539 aa AA seqDB search
MCCSERLPGLPPPVGMEALDQAEGPAASPREMPPPPPPAPPSEPAQKPPPRGPGSPSLTV
RSSLCLLAASQFLLACGMLWLSGYGPFWSQNATDLISSVLSLLEQLGPSAWLGVGTWGIP
CLLLASLSVVLLTTLVWYLLRAPPEPPAPLPPEDRRQSVSRQPSFTYSEWMEEKVEDDFL
DLDPVPETPVFDCVMDIKPEADPASLTVKSMGLQERRGSNVSLTLDMCTPGCNEEGFGYL
MSPREESAREYLLSASRVLQAEELHEKALDPFLLQAEFFEIPMNFVDPKEYDIPGLVRKN
RYKTILPNPHSRVCLTSPDPDDPLSSYINANYIRGYGGEEKVYIATQGPIVSTVGDFWRM
VWQEHTPIIVMITNIEEMNEKCTEYWPEEQVVYDGVEITVRKVIHTEDYRLRLIALRSGT
EERGLKHYWFTSWPDQKTPDRAPPLLHLVREVEEEAQQEGPRCAPIVVHCSAGIGRTGCF
IATSICCQQLRQEGVVDILKTTCQLRQDRGGMIQTCEQYQFVHHVMSLYEKQLSRQSLE
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgtgctgcagcgagaggctgccgggtctccccccgccggtagggatggaggcgctggac
caggccgaggggcccgcagcctctccgagagagatgccaccgcccccacctcctgcaccg
ccctcagagccagctcagaagccgccacctcggggccctgggagcccctccctcactgtc
aggagcagcctgtgcctgttggctgcctcccagttcctgcttgcctgcgggatgctttgg
ctcagcggctatggccccttctggtcgcagaatgccaccgacctcatctcctctgtgctc
tcgctcctggagcagctgggaccctcggcctggctgggcgttgggacctggggcatcccc
tgtctgctgctggcctctctgtctgtggtcctcctcaccaccctggtgtggtacctcctg
agggctccaccagagccacccgccccactgccccccgaagacaggcgccagtctgtgagc
cgtcagccctccttcacctactcggagtggatggaggagaaggttgaagatgacttcctg
gacctggatcccgtccctgagacgcctgtgtttgactgtgtgatggacatcaaacctgag
gccgaccccgcctcactgaccgtcaagtccatgggtctgcaggagaggaggggctccaac
gtctccctgaccctggacatgtgcacgccgggctgcaacgaggagggcttcggctatctc
atgtccccgcgcgaggagtcagcccgtgagtacctgctcagcgcttcccgtgtcctccag
gctgaggagcttcacgagaaggccctggaccccttcctgctgcaggcagaattctttgaa
atccccatgaactttgtggatccaaaagagtatgacatccctgggctggtgcggaagaac
cggtacaaaaccatccttcccaatcctcacagcagagtgtgtctgacttcaccagacccc
gacgaccctctgagttcctacatcaacgccaactacatccggggctacggtggggaagag
aaggtgtacatcgccactcagggacccatcgtcagcaccgtcggcgacttctggcgcatg
gtgtggcaggagcacacgcccatcattgtcatgatcacaaacatcgaggagatgaacgag
aagtgcaccgagtattggccggaggagcaggtggtgtacgatggcgtcgagatcaccgtg
cggaaagtcatccacactgaggattaccggctacgactcatcgccctcaggagcgggaca
gaagaacgaggcctgaagcattactggttcacatcctggcccgaccagaagactccagac
cgggccccccctctcctgcacctggtgcgggaggtggaggaggaagcccagcaggagggg
ccacggtgcgcccccatcgtcgtccactgcagcgcagggatcgggaggacaggctgcttc
atcgccaccagcatctgctgccagcagctgcggcaggagggcgtggtggacatcctgaag
accacgtgccagctccgtcaggacaggggcggcatgatccagacgtgtgaacagtaccag
ttcgtgcatcacgtcatgagcctctacgagaagcagctgtcccgccagtccctggagtga

DBGET integrated database retrieval system