KEGG   Sus scrofa (pig): 100524423Help
Entry
100524423         CDS       T01009                                 

Gene name
PNPLA6
Definition
patatin-like phospholipase domain containing 6
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
ssc  Sus scrofa (pig)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100524423 (PNPLA6)
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     100524423 (PNPLA6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 1349 aa AA seqDB search
MMLCTVKDPDFRLPDLTPSQRQLMEAPLQTGVVLGVMIGAGVAVLVTAVLILLLVRRLRV
PKTPAPDGPRYRFRKRDKVLFYGRKIMRKVSQSTSSLVDASVSTASRPRMKKKLKMLNIA
KKILRIQKEAPTLQRKEPPPAVLEADLTEGDLANSHLPSEVLYMLKNVRVLGHFEKPLFL
ELCRHMVFQRLGQGDYVFRPGQPDASIYVVQDGLLELCLPGPDGKECVVKEVVPGDSVNS
LLSILDVITGHQHPQRTVSARAARDSTVLRLPVEAFSAVFTKYPESLVRVVQIIMVRLQR
VTFLALHNYLGLTNELFSHEIQPLRLFPSPGLPARTSPVRGSKRVISTSAADEPRETPGR
PPDPTGAPLPGPPGELVKPTSLEAPSAPLLSRCISMPVDISGLQGGPRSDFDMAYERGRI
SMSLQEETSGVIQAAPARTPTQELREQPAGACEYSYCEDESATGRCPFGPYQGRQTSSIF
EAAKQELAKLMRIEDPALLNSRVLLHHAKAGTIIARQGDQDVSLHFVLWGCLHVYQRMIN
KAEDVCLFVAQPGELVGQLAVLTGEPLIFTLRAQRDCTFLRISKSDFYEIMRAQPSVVLS
AAHTVAARMSPFVRQMDFAIDWTAVEAGRALYRQGDRSDCTYIVLNGRLRSVIQRGSGKK
ELVGEYGRGDLIGVVEALTRQPRATTVHAVRDTELAKLPEGTLGHIKRRYPQVVTRLIHL
LSQKILGNLQQLQGPFPGSGLGVPPHSELTNPASNLATVAVLPVCAEVPMVAFMLELQHA
LQAIGPTLLLNSDIIRARLGASALDSIQEFRLSGWLAQQEDTHRIVLYQTDTSLTPWTVR
CLRQADCILIVGLGDQEPTLGQLEQMLENTAVRALKQLVLLHREEGPGPTRTVEWLNMRS
WCSGHLHLRCPRRLFSRRSPAKLHELYEKVFSRRADRHSDFSRLARVLTGNTIALVLGGG
GARGCSHIGVLKALEEAGVPVDLVGGTSIGSFIGALYAEERSASRTKQRAREWAKSMTSV
LEPMLDLTYPVTSMFTGSAFNRSVHRVFQDKQIEDLWLPYFNVTTDITSSAMRVHKDGSL
WRYVRASMTLSGYLPPLCDPKDGHLLMDGGYINNLPADIARSMGAKTVIAIDVGSQDETD
LSTYGDSLSGWWLLWKRLNPWADKIKVPDMAEIQSRLAYVSCVRQLEVVKSSSYCEYLRP
PIDCFKTMDFGKFDQIYDVGYQYGKAVFGGWSRGDIIEKMLTDQRSADLNESRRADVLAF
PSSGFTDLAEIVSRIEPPTSYVSDGCADGEESDCLTEYEEDAGPDCSRDEGGSPEGASPS
TASEMEEEKSILRHRRCLPQDPPSSAADA
NT seq 4050 nt NT seq  +upstreamnt  +downstreamnt
atgatgctctgcaccgtcaaagaccccgacttcagattaccagacctgacgcccagccag
aggcaactgatggaggcccctctgcaaaccggagtggtgctgggcgtgatgatcggggct
ggagtcgcggtgctggtcacggccgtgctcatcctcctgctggtgcggaggcttcgagtg
ccgaaaaccccagccccggatggcccgcggtatcgattccggaagagagacaaagtactt
ttctatggccggaagattatgcggaaggtatcacaatccacttcttccctggtggacgcc
tcggtctccaccgcttcccggccacgaatgaagaaaaaacttaagatgctcaacatcgcc
aagaagatcctgcgcatccagaaagaggcgccaacactgcagcggaaggagcccccaccc
gcagtgctggaggctgacctgacagagggggacctggccaactcccacctgccctctgag
gtgctctacatgctcaagaacgtccgggtgctgggccactttgagaagccgctcttcctg
gagctgtgccggcacatggtcttccagcggctcggccagggtgactacgtcttccggccg
ggccagcctgatgccagcatctacgtggtacaggacgggctgctggagctctgtctgccg
ggacctgatgggaaggagtgtgtggtgaaggaggtggttcctggagacagtgttaacagc
ctccttagcatcctggatgtcatcaccggtcaccagcacccccagcggactgtgtctgcc
cgggcggcccgagactccacagtgctgcgcctgccggttgaagccttctctgcagtcttc
accaagtaccctgagagcctggtgcgggtggtgcagatcatcatggtcaggctgcaacgg
gtcacttttctggcgcttcacaactacctgggtctgaccaatgagctcttcagccacgag
atccagcccctgcgcctattccccagcccggggctcccagcccgcaccagccctgtgcgt
ggctccaagcgggtgatcagcacatcagctgctgatgagcccagggagactcctggccgg
ccgcctgaccccactggggccccactgcctggacctccaggggagctggtgaagcccacg
tccctggaagccccctcggcccccttgctgagtcgctgcatctccatgccagtggacatc
tcaggcttgcagggtggcccccgctcagactttgacatggcatatgagcgtggccggatc
tccatgtccttgcaggaagagacctcaggggtgattcaggcagcccctgctaggacccct
actcaggagctgcgggagcagccggcaggtgcctgcgagtacagctactgcgaggatgag
tcggccaccggcaggtgccccttcgggccctaccagggccgccagacaagcagcatcttt
gaggcagcaaagcaggagctggccaagctgatgcggattgaggaccccgcccttctcaat
agccgagtcttgctgcatcacgccaaagctggtaccatcattgcccgccagggggaccag
gatgtgagcctgcattttgtgctctggggctgcctgcacgtctaccagcgcatgatcaac
aaggctgaggacgtgtgcttgttcgtcgcacagcctggggaactggtggggcagctggct
gtgctcactggtgaaccccttatctttacactgcgagcccagcgcgactgcaccttcctg
aggatctccaagtctgatttctatgagatcatgcgtgcacagcccagtgtggtgctgagc
gctgcgcacactgtggctgcgaggatgtcacccttcgtgcgccagatggacttcgccatc
gactggacggcagtggaggcaggacgtgctctgtacaggcagggagaccgttctgactgc
acctacatcgtgctcaatggtcggctgcgtagtgtcatccagcgtggcagcggcaagaag
gagctggtgggcgagtatggccgcggggatctcataggagtggtggaagcactgacaagg
cagccacgcgccacgacggtgcacgcagtgcgtgacacggagttggccaaactccctgag
ggcactctgggccacatcaaacgtcgatacccacaggtcgtgactcgccttatccacctt
ttgagccagaaaattctggggaatttgcagcagctgcaaggaccctttccaggctcggga
cttggtgtcccccctcactcggagctcaccaacccagccagcaacctggcaacggtggca
gtgttgcctgtgtgtgccgaggtgcccatggtggccttcatgctggagctgcagcatgct
ctacaagccatcggccctacactcctcctcaacagtgacatcatccgggcgcgcctgggg
gcttctgcactggacagcatccaagaattccggctgtcaggatggctggcccagcaggag
gacacgcaccgcatcgtgctctaccagacagacacatcgctgacgccctggaccgtgcgt
tgcttgcgccaggccgactgcatcctcatcgtgggcctgggcgaccaggaacccacactc
ggccagctggagcagatgctggagaatacggccgtgcgcgccctcaagcagctggtcctg
ctgcaccgtgaggaaggcccgggccccacgcgcacagtggagtggctcaacatgcgcagc
tggtgctcagggcacctgcatctgcgctgtccgcgccgccttttctcgcgccgcagccct
gccaagctgcatgagctctacgagaaggttttctcgaggcgcgcggaccggcacagcgac
ttctctcgcctggcgcgagtgctcacaggcaacaccatcgcccttgtgctgggtgggggc
ggagccaggggctgctcacatattggggtgctgaaggcattggaggaggcgggggtccct
gtcgacctggtgggcggcacgtccatcggctctttcatcggggccctgtatgcggaggag
cggagcgcgagccgcactaagcagcgtgcccgggagtgggccaagagcatgacttcggtg
ctggagcccatgctggacctcacctaccccgtcacctccatgttcacggggtcagccttc
aaccgcagtgtccaccgggtcttccaggacaagcaaatcgaggatctgtggctgccatac
ttcaacgtcaccacagacatcacctcctcagccatgcgtgtccacaaagatggctccttg
tggcgatacgtgcgtgccagcatgaccctctcaggctacctgccgccactgtgcgacccc
aaggacgggcacctcctcatggacggcggctacatcaacaacctgccagcggacattgcc
cgcagcatgggtgccaagacagtcatcgccattgacgtggggagccaggatgaaacagac
ctcagcacctacggggacagcctgtctggctggtggctgctgtggaagcggctgaacccc
tgggcagacaagatcaaggttccagacatggctgagatccagtctcgcctggcctatgtg
tcctgcgtgcggcagctggaggtcgtgaagtctagctcctattgcgagtacctgcgccca
cccattgactgcttcaagaccatggacttcgggaagtttgaccagatctatgatgtgggc
taccaatacgggaaggcggtctttgggggctggagccgcggcgacatcattgaaaagatg
ctcacggaccagcgatctgctgaccttaatgagagccgccgtgcagatgtactcgccttc
cccagctccggcttcaccgacttggctgagatcgtgtcccggatcgagccccccaccagc
tacgtttctgatggctgtgctgatggagaggagtcggactgcctgacagagtacgaggag
gatgcaggacctgattgctcacgggatgaaggcggctctcccgagggcgcgagccccagc
accgcctccgagatggaggaggagaagtcgattttgcggcaccggcgctgtctgccgcag
gacccccccagctcagctgcggatgcctga

DBGET integrated database retrieval system