KEGG   Sus scrofa (pig): 100524618Help
Entry
100524618         CDS       T01009                                 

Gene name
GPT
Definition
glutamic-pyruvate transaminase (alanine aminotransferase)
Orthology
K00814  
alanine transaminase [EC:2.6.1.2]
Organism
ssc  Sus scrofa (pig)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:ssc01200]
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:ssc01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:ssc01230]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:ssc00250]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
4
AA seq 555 aa AA seqDB search
MVPSAGGARWNLCLIASLPSPDSPRILDAWLSYLGDRLVAQAKMGGRRGLGLGRALLGVM
ALRAGGHSQAAMNGLKEKVLTLDSMNPCVQRVEYAVRGPIVLRALELEQELRQGVKKPFT
EVIRANIGDAQAMGQKPITFLRQVLALCIHPDLLNSADFPEDAKRRAQRILQACGGHSLG
AYSISPGIQMIREDVARYIERRDGGIPADPNNIFLSTGASDAIVTVLKLLVFGEGRTRTG
VLIPIPQYPLYSAALAELNAVQVDYYLDEERAWALDVAELRRALRQARDHCRPRALCVIN
PGNPTGQVQTRECIEAVIRFAYEEGLFLLADEVYQDNVYAEGSQFHSFKKVLTEMGPPYA
ARQELASFHSVSKGFMGECGFRGGYVEVVNMDAAVQQQMQKLRSVRLCPPTPGQVLLDAV
LSPPAPSDPSFAQFQAEKREVLAELAAKAKLTEQVFNEAPGIHCNPVQGAMYSFPRVQLP
PRAVQRAQELGLAPDMFFCMRLLEETGICVVPGSGFGQREGTYHFRMTILPPMEKLRPLL
EKLSQFHAKFTLEYS
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atggtccccagcgcgggaggggccagatggaacctgtgtctgatcgcctcacttccctcc
cccgacagccccaggattcttgacgcctggctcagttacctgggagacaggctggtggcc
caagcaaagatggggggtcggagagggctgggcctcggccgagccctactgggggtcatg
gccttgagggcaggtggccacagccaggctgccatgaacgggctgaaggagaaggtgcta
acgctggactccatgaacccctgcgttcagagggtggagtacgcggtgcgcggccccatc
gtgctacgcgccctggagctggagcaggagctgcgccagggggtaaagaagcccttcact
gaggtcatccgagccaacatcggggatgcccaggccatggggcagaagcctatcaccttc
ctgcggcaggtcctggccctctgcatccaccctgatctcctgaacagtgctgacttcccg
gaggatgccaagagaagagcacagcgcatcctgcaggcgtgcgggggccacagcctgggg
gcctacagcatcagccctggcatccagatgatccgcgaggatgtggctcggtacatcgag
cggcgcgacggaggcattcccgcagaccccaacaacatcttcctgtccacgggggccagc
gacgccatcgtgaccgtgctcaagttgctagtgttcggcgagggtcgcacgcgcacgggc
gtgctcatccccatccctcagtatccactctactccgccgcgctggccgagctcaacgcc
gtgcaggtggactactacctggacgaggagcgcgcctgggcgctcgacgtggccgagctg
cggcgcgcgctgcgccaggcgcgtgaccactgccgtccccgcgcgctctgcgtgatcaac
cccggcaaccccaccgggcaggtgcagactcgcgagtgcatcgaggccgtgatccgcttc
gcctatgaggaggggctcttcctgctggccgatgaggtgtatcaggacaacgtgtacgcc
gagggctcgcagttccactcgttcaagaaggtgctcacggagatggggccgccgtacgcg
gcgcggcaggagctcgcatccttccactcggtctccaagggcttcatgggcgagtgcggc
ttccgcggcggctacgtggaggtggtgaacatggacgccgcggtgcagcagcagatgcag
aagctgaggagcgtgcggctgtgcccgcctacgccgggccaggtcctgctggacgcggtg
ctcagcccgcccgcgccctcagacccctccttcgcgcagttccaggcggagaagcgggag
gtgctggccgagctggcggccaaggccaagctcactgaacaggtcttcaacgaggctccc
ggcatccactgcaacccggtgcagggcgccatgtactccttcccgcgcgtgcagctgccc
ccccgcgccgtgcagcgcgctcaggagctgggcctggctccggacatgttcttctgcatg
cgccttctggaggagactggcatctgcgtggtgcctgggagcggctttgggcagcgcgaa
ggcacctaccacttccggatgaccattctgccccccatggaaaagttgcggcccctgctg
gagaagctgagccagttccacgccaagttcactctcgagtactcctga

DBGET integrated database retrieval system