KEGG   Sus scrofa (pig): 100524749Help
Entry
100524749         CDS       T01009                                 

Gene name
PADI4
Definition
peptidyl arginine deiminase, type IV
Orthology
K01481  
protein-arginine deiminase [EC:3.5.3.15]
Organism
ssc  Sus scrofa (pig)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Vega: 
UniProt: 
Position
6
AA seq 666 aa AA seqDB search
MAQGPVIHVAPEKPTYAVCVLGTETQLDVYGSAPNGYTSFSIDASPGVVVDVAHSPPAKK
NRTGPSRWLLDPGLEVSLRMRAASNSTSDQKVQISYYGPETAPVQALLYITGVEISLSAD
IARTGKIKPTGGRKDQRSWTWGPRGQGAILLVNCDRDSPESPTMDCNDDRVLDSNDLQDM
SLVTLSTKTPWDFFSKHQLVLHVAKSMMDKVRVFQGNADKQPSSYRMVLGPQQPCHSLEL
PGGQHSVDFYVEGLAFPDASFSGLISLQVSLLDASNPELPKALIFQDSVVFRVAPWIMTP
NTQPPKEVYVCRIIESEDFLMSVAALAKKAKCKLIICTKEESMDDRWMQDEMEIGYIQAP
HKTMPVVFDSPRNRGLKDFPVKCMLGPDFGYVTRMPQTGRVTDLDSFGNLEVSPPVTVGK
KEYPLGRILFGDSGYPSQESQEMHQALQDFLGAQQVQAPVKLYSDWLSVGHVDEFLSFVP
VYKKGFRLLLASPRSCYKLFEEQLKKGHGEALLFQGLKRKKQQKIKDILSNKKLREHNSY
VESCIDWNRAVLKRELGLTERDIVDIPQLFKLQEDIRGILKAEAFFPNMVNMLVLGKYLG
IPKPFGPIINGRCCLEEKVRSLLEPLGLHCTFIDDFFSYHVRHGDVHCGTNVRRQPFSFK
WWHMVP
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atggcccaagggcctgtgatccatgtggccccagagaagcccacctatgccgtgtgcgtg
ctgggcaccgagactcagctggatgtctacggctctgcccccaatggctacacctccttc
agcatcgatgcctccccgggggtggtcgtggatgttgctcacagccctcctgccaaaaag
aatcgcacaggtccctccaggtggctcctggaccctgggctggaggtgagcctgaggatg
agagctgccagcaatagcacaagtgaccagaaggttcagatttcatactatggacctgag
accgccccagtccaagccctgctctacatcactggggttgaaatctccctgagcgcagac
atcgcccgcactggcaaaataaagcccaccggaggcaggaaagaccagaggtcctggacc
tggggccctcgtgggcagggcgccatcctgctggtgaactgtgacagagacagtcctgaa
tctcccaccatggactgcaatgatgaccgggtgctggacagcaatgacctgcaggacatg
tccctggtgaccctgagcacgaagaccccctgggacttcttcagcaagcatcagctggtg
ctccacgtggccaaatccatgatggacaaagtcagggtgtttcaaggcaacgcagacaaa
cagccctccagctaccgcatggtcctggggccgcagcagccatgtcactcgctggagctc
cctggtggccagcacagtgtggacttctatgtggagggcctggctttccccgacgccagc
ttctcggggcttatttccctccaggtctctctgttggatgcgtccaatccggagctcccc
aaggccctgattttccaagacagcgtggtcttccgtgtggccccctggatcatgaccccc
aacactcagccccccaaggaggtgtatgtgtgcaggataattgaaagtgaggacttccta
atgtcagtggctgctctggccaagaaagccaagtgcaagctgatcatctgtaccaaggag
gagagcatggacgaccggtggatgcaggatgagatggagattggctacatccaagcccca
cacaaaacaatgccggtggtcttcgactcaccgaggaacagaggcttgaaggatttcccc
gtcaaatgcatgctgggtccagattttggctacgtgactcgaatgccccaaacagggagg
gtgactgaccttgactcctttgggaacctggaagtgagtcccccggtcacggtcgggaag
aaggaatacccgctgggcaggattctctttggagacagtggttaccccagccaggaaagc
caggagatgcaccaggccctgcaggatttccttggcgcccagcaggtgcaggccccagtg
aaactctactctgactggctgtctgtgggccacgtggacgagttcctgagcttcgttccg
gtgtacaagaagggtttccgactgctcctggccagccccaggtcctgctacaaactgttc
gaggagcagctgaagaagggccacggggaggccctgctgtttcaagggctcaagagaaaa
aaacagcagaaaataaaagacattctgtcaaacaagaaactgagagaacacaattcctat
gtggagagctgcattgactggaaccgggcggtgctgaagcgggagctgggtctgaccgag
agggacatcgtggacatcccccagctcttcaagctccaggaagacatccgagggatcctc
aaggccgaagcctttttcccaaacatggtgaacatgctggtgctggggaagtacctgggc
atccccaagcccttcgggcccatcatcaatggccgctgctgcctggaggagaaggtgcgc
tccctgctggagccgctgggcctccactgcaccttcattgacgacttcttctcctaccat
gtccggcacggggatgtgcactgcggcaccaacgtgcgccggcagcccttctccttcaag
tggtggcacatggtgccctga

DBGET integrated database retrieval system