KEGG   Sus scrofa (pig): 100524822Help
Entry
100524822         CDS       T01009                                 

Gene name
REN
Definition
(RefSeq) renin
  KO
K01380  
renin [EC:3.4.23.15]
Organism
ssc  Sus scrofa (pig)
Pathway
Renin-angiotensin system
Renin secretion
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Organismal Systems
  Endocrine system
   04924 Renin secretion
    100524822 (REN)
   04614 Renin-angiotensin system
    100524822 (REN)
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.15  renin
     100524822 (REN)
Peptidases [BR:ssc01002]
 Aspartic Peptidases
  Family A1: pepsin family
   100524822 (REN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
9
AA seq 369 aa AA seqDB search
MPSVRESLKERGVDMARLGAEWSQFSKRLSFGNRTSPVVLTNYLDTQYYGEIGIGTPPQT
FKVIFDTGSANLWVPSTKCSPLYTACEIHSLYDSSESSSYVENGTEFTIHYGSGKVKGFL
SQDLVTVGGFTVTQTFGEVTELPLIPFMLAKFDGVLGMGFPAQAVGGVTPVFDHILSQKV
LKEDVFSVYYSRNSKNSQLLGGEIVLGGSDPQYYQDSFHYVSISKTGSWQIKMKGVSVRS
ATLLCEEGCMVVVDTGASYISGPTSSLRLLMETLGAKELSTDEYVVNCNQVPTLPDISFH
LGGRAYTLTSADYVLQDPYNNDDLCTLALHGLDVPPPTGPVWVLGASFIRKFYTEFDRRN
NRIGFALAR
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgccctcagtccgggaaagcctgaaggagcgaggcgtggacatggccaggctgggtgct
gagtggagccagttcagcaagagactctcctttggcaacagaaccagccccgtggtcctc
accaactacctggatacccagtactatggcgagatcggcattggcaccccgccacagacc
ttcaaagtcatcttcgacacaggctcggccaacctctgggtgccctccaccaaatgcagc
cctctctacacggcctgtgagattcacagcctctacgactcctcggaatcctccagctat
gtggaaaacgggacggaattcaccatccactatgggtccgggaaggtcaaaggcttcctg
agccaggacctagtgactgtgggcggattcacagtcacacagacgtttggagaggtcaca
gagctgcccctgatccccttcatgctggccaagttcgatggtgttctgggcatgggcttc
cctgcacaggccgtcggcggggtcacccccgtctttgaccacatcctttcccagaaggtg
ctgaaggaggacgttttctccgtctactacagcagaaattccaagaattcccagttgctg
gggggagagattgtgctgggcggcagtgacccccagtattaccaggacagtttccactac
gtgagcatcagcaagactggctcctggcagatcaaaatgaaaggggtgtctgtgaggtcg
gccaccttgctctgtgaggagggctgcatggtggtagtggataccggggcatcctacatc
tcaggtcccactagctccctgaggctgctcatggagaccctgggggccaaggagctgagc
acagatgaatatgttgtgaactgtaaccaagtgcccacactccccgacatctccttccat
ctcggaggcagagcctacacgctcaccagtgcggactacgtcttacaggacccctacaat
aacgatgatctgtgcacactggccctccacggtctggacgttccaccgcccactggaccc
gtctgggtccttggtgccagcttcatccgaaagttctacacggagtttgatcgacgtaac
aatcgcattggctttgccctggcccgctga

DBGET integrated database retrieval system