KEGG   Sus scrofa (pig): 100524940Help
Entry
100524940         CDS       T01009                                 

Definition
cytochrome P450 2J2-like
Orthology
K07418  
cytochrome P450, family 2, subfamily J [EC:1.14.14.1]
Organism
ssc  Sus scrofa (pig)
Pathway
Arachidonic acid metabolism
Linoleic acid metabolism
Metabolic pathways
Serotonergic synapse
Inflammatory mediator regulation of TRP channels
Ovarian steroidogenesis
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    100524940
   00591 Linoleic acid metabolism
    100524940
 Organismal Systems
  Endocrine system
   04913 Ovarian Steroidogenesis
    100524940
  Nervous system
   04726 Serotonergic synapse
    100524940
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100524940
Enzymes [BR:ssc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100524940
Cytochrome P450 [BR:ssc00199]
 Cytochrome P450, animal type
  CYP2 family
   100524940
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Vega: 
UniProt: 
Position
6
AA seq 502 aa AA seqDB search
MPLALGSLAEALWTALRPSTILLGAVAFLFFADFLKKRRPKNYPPGPPRLPFIGNLFHLD
LDKGHLSLQRFVKKYGNVFSLDFGALSSVVITGLPFIKEAFVHQDKNFSNRPIVPIQQRV
FKDKGVVMSNGQVWKEQRRFALTTLRNFGLGKKSLEERIQEEAQYLIQAIGEENGQPFNP
HFKINNAVSNIICSITFGERFDYQDNQFQELLKLLDEVMCLQTSVWCQIYNIIPWIMKFL
PGPHQTLFSNWEKLKMFVAHVIENHRRDWNPAEARDFIEAYLQEIEKHKGDATSSFQEEN
LICSTLDLFVAGTETTSTTLRWGLLYMALYPEIQEKVQAEIDRVLGQLQQPSTAARESMP
YTNAVIHEVQRMGNIIPLNVPREVAEDTTLAGYHLPKGTMVIANLTALHSDPTEWATPDT
FNPEHFLENGKFKKREAFLPFSVGKRACLGEQLARTELFVFFTSLLQKFSFRPPDNEKLS
LKFRMGLTLSPVTYRICAVPRA
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgccgctggccttgggctccctggctgaggctctctggacggcgctccgtcccagcact
atcctgctgggcgccgtcgcctttctcttctttgctgatttcctcaaaaagcggcgccca
aagaactacccgcctgggcccccgcggcttcccttcataggcaacctcttccatctggac
ttagacaagggacacctgtcacttcagcggtttgtgaagaaatatgggaatgtttttagc
ctggattttggtgcattgtcttctgttgtcataactggattgcctttcatcaaagaagcc
tttgtccatcaggacaaaaacttttcaaaccgccccatagtccctatccaacaacgtgtc
tttaaggacaaaggagtggtcatgtccaatggccaggtatggaaggagcaaagaaggttc
gccctgacaacactgaggaactttggtttaggaaagaagagcttagaggaacgcattcag
gaagaggctcagtacctcatccaggcaataggagaggagaatggacaacctttcaaccct
catttcaaaatcaacaatgctgtttccaacatcatttgctccatcacatttggagaacgc
tttgactaccaggataatcagttccaggagctgctgaagctgctggatgaggtcatgtgt
cttcagacatcagtgtggtgccagatttacaatatcattccatggataatgaaattcctt
cctggaccccaccaaaccctcttcagtaattgggagaaactgaaaatgtttgttgcccat
gtgattgaaaaccacaggagagactggaatcctgctgaagcaagagacttcattgaggct
tacctccaggaaatagaaaagcataagggtgatgctacttcaagtttccaagaagaaaac
ctcatctgtagcaccctggacctcttcgttgctggaactgagaccacgtcaacaacactg
cgctggggtctgctgtacatggccctgtaccctgaaatccaagagaaagtccaagctgag
attgacagggtgcttggccaattacagcagccgagcacagcagctcgagagtccatgccc
tacaccaacgccgtcatccatgaggtgcagagaatgggcaacatcatccccctgaacgtg
ccccgggaggtggcagaggataccaccctggctggataccacctgcccaaggggacgatg
gtcatagccaatctgactgcactacatagcgaccccacagagtgggccaccccagacaca
ttcaatccagagcattttctggagaatggaaagtttaagaaaagggaagcctttctgcct
ttctcagtagggaagcgggcgtgccttggagagcagctggccaggactgagctgttcgtt
ttctttacttcccttttacaaaaattctccttcaggcctccagacaatgagaagctgagc
ctcaagttcagaatgggcctgaccctctccccagtcacctaccgcatctgtgcagttccc
agggcatga

DBGET integrated database retrieval system