KEGG   Sus scrofa (pig): 100524940Help
Entry
100524940         CDS       T01009                                 

Definition
(RefSeq) cytochrome P450 2J2 isoform X1
  KO
K07418  cytochrome P450 family 2 subfamily J [EC:1.14.14.1]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00590  Arachidonic acid metabolism
ssc00591  Linoleic acid metabolism
ssc01100  Metabolic pathways
ssc04726  Serotonergic synapse
ssc04750  Inflammatory mediator regulation of TRP channels
ssc04913  Ovarian steroidogenesis
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    100524940
   00591 Linoleic acid metabolism
    100524940
 Organismal Systems
  Endocrine system
   04913 Ovarian Steroidogenesis
    100524940
  Nervous system
   04726 Serotonergic synapse
    100524940
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100524940
Enzymes [BR:ssc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100524940
Cytochrome P450 [BR:ssc00199]
 Cytochrome P450, animal type
  CYP2 family
   100524940
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450 Bac_rhamnosid6H DUF1381
Motif
Other DBs
NCBI-GeneID: 100524940
NCBI-ProteinID: XP_003128009
Ensembl: ENSSSCG00000003825
Vega: OTTSUSG00000001858
Position
6
AA seq 539 aa AA seqDB search
MGGGAGKVGGAGSWRPRPQTGLDHLGLRSPKSWRLAAMPLALGSLAEALWTALRPSTILL
GAVAFLFFADFLKKRRPKNYPPGPPRLPFIGNLFHLDLDKGHLSLQRFVKKYGNVFSLDF
GALSSVVITGLPFIKEAFVHQDKNFSNRPIVPIQQRVFKDKGVVMSNGQVWKEQRRFALT
TLRNFGLGKKSLEERIQEEAQYLIQAIGEENGQPFNPHFKINNAVSNIICSITFGERFDY
QDNQFQELLKLLDEVMCLQTSVWCQIYNIIPWIMKFLPGPHQTLFSNWEKLKMFVAHVIE
NHRRDWNPAEARDFIEAYLQEIEKHKGDATSSFQEENLICSTLDLFVAGTETTSTTLRWG
LLYMALYPEIQEKVQAEIDRVLGQLQQPSTAARESMPYTNAVIHEVQRMGNIIPLNVPRE
VAEDTTLAGYHLPKGTMVITNLTALHSDPTEWATPDTFNPEHFLENGKFKKREAFLPFSV
GKRACLGEQLARTELFVFFTSLLQKFSFRPPDNEKLSLKFRMGLTLSPVTYRICAVPRA
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atggggggaggtgctggaaaggtgggcggggctgggagctggaggccgaggccccagacc
ggactggaccacctgggcctcagatctccgaagagctggaggctagcagccatgccgctg
gccttgggctccctggctgaggctctctggacggcgctccgtcccagcactatcctgctg
ggcgccgtcgcctttctcttctttgctgatttcctcaaaaagcggcgcccaaagaactac
ccgcctgggcccccgcggcttcccttcataggcaacctcttccatctggacttagacaag
ggacacctgtcacttcagcggtttgtgaagaaatatgggaatgtttttagcctggatttt
ggtgcattgtcttctgttgtcataactggattgcctttcatcaaagaagcctttgtccat
caggacaaaaacttttcaaaccgccccatagtccctatccaacaacgtgtctttaaggac
aaaggagtggtcatgtccaatggccaggtatggaaggagcaaagaaggttcgccctgaca
acactgaggaactttggtttaggaaagaagagcttagaggaacgcattcaggaagaggct
cagtacctcatccaggcaataggagaggagaatggacaacctttcaaccctcatttcaaa
atcaacaatgctgtttccaacatcatttgctccatcacatttggagaacgctttgactac
caggataatcagttccaggagctgctgaagctgctggatgaggtcatgtgtcttcagaca
tcagtgtggtgccagatttacaatatcattccatggataatgaaattccttcctggaccc
caccaaaccctcttcagtaattgggagaaactgaaaatgtttgttgcccatgtgattgaa
aaccacaggagagactggaatcctgctgaagcaagagacttcattgaggcttacctccag
gaaatagaaaagcataagggtgatgctacttcaagtttccaagaagaaaacctcatctgt
agcaccctggacctcttcgttgctggaactgagaccacgtcaacaacactgcgctggggt
ctgctgtacatggccctgtaccctgaaatccaagagaaagtccaagctgagattgacagg
gtgcttggccaattacagcagccgagcacagcagctcgagagtccatgccctacaccaac
gccgtcatccatgaggtgcagagaatgggcaacatcatccccctgaacgtgccccgggag
gtggcagaggataccaccctggctggataccacctgcccaaggggacgatggtcataacc
aatctgactgcactacatagcgaccccacagagtgggccaccccagacacattcaatcca
gagcattttctggagaatggaaagtttaagaaaagggaagcctttctgcctttctcagta
gggaagcgggcgtgccttggagagcagctggccaggactgagctgttcgttttctttact
tcccttttacaaaaattctccttcaggcctccagacaatgagaagctgagcctcaagttc
agaatgggcctgaccctctccccagtcacctaccgcatctgtgcagttcccagggcatga

DBGET integrated database retrieval system