KEGG   Sus scrofa (pig): 100524940Help
Entry
100524940         CDS       T01009                                 

Definition
cytochrome P450 2J2-like
Orthology
K07418  
cytochrome P450, family 2, subfamily J [EC:1.14.14.1]
Organism
ssc  Sus scrofa (pig)
Pathway
Arachidonic acid metabolism
Linoleic acid metabolism
Metabolic pathways
Serotonergic synapse
Inflammatory mediator regulation of TRP channels
Ovarian steroidogenesis
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:ssc00590]
Metabolism; Lipid metabolism; Linoleic acid metabolism [PATH:ssc00591]
Organismal Systems; Endocrine system; Ovarian Steroidogenesis [PATH:ssc04913]
Organismal Systems; Nervous system; Serotonergic synapse [PATH:ssc04726]
Organismal Systems; Sensory system; Inflammatory mediator regulation of TRP channels [PATH:ssc04750]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Vega: 
UniProt: 
Position
6
AA seq 502 aa AA seqDB search
MPLALGSLAEALWTALRPSTILLGAVAFLFFADFLKKRRPKNYPPGPPRLPFIGNLFHLD
LDKGHLSLQRFVKKYGNVFSLDFGALSSVVITGLPFIKEAFVHQDKNFSNRPIVPIQQRV
FKDKGVVMSNGQVWKEQRRFALTTLRNFGLGKKSLEERIQEEAQYLIQAIGEENGQPFNP
HFKINNAVSNIICSITFGERFDYQDNQFQELLKLLDEVMCLQTSVWCQIYNIIPWIMKFL
PGPHQTLFSNWEKLKMFVAHVIENHRRDWNPAEARDFIEAYLQEIEKHKGDATSSFQEEN
LICSTLDLFVAGTETTSTTLRWGLLYMALYPEIQEKVQAEIDRVLGQLQQPSTAARESMP
YTNAVIHEVQRMGNIIPLNVPREVAEDTTLAGYHLPKGTMVIANLTALHSDPTEWATPDT
FNPEHFLENGKFKKREAFLPFSVGKRACLGEQLARTELFVFFTSLLQKFSFRPPDNEKLS
LKFRMGLTLSPVTYRICAVPRA
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgccgctggccttgggctccctggctgaggctctctggacggcgctccgtcccagcact
atcctgctgggcgccgtcgcctttctcttctttgctgatttcctcaaaaagcggcgccca
aagaactacccgcctgggcccccgcggcttcccttcataggcaacctcttccatctggac
ttagacaagggacacctgtcacttcagcggtttgtgaagaaatatgggaatgtttttagc
ctggattttggtgcattgtcttctgttgtcataactggattgcctttcatcaaagaagcc
tttgtccatcaggacaaaaacttttcaaaccgccccatagtccctatccaacaacgtgtc
tttaaggacaaaggagtggtcatgtccaatggccaggtatggaaggagcaaagaaggttc
gccctgacaacactgaggaactttggtttaggaaagaagagcttagaggaacgcattcag
gaagaggctcagtacctcatccaggcaataggagaggagaatggacaacctttcaaccct
catttcaaaatcaacaatgctgtttccaacatcatttgctccatcacatttggagaacgc
tttgactaccaggataatcagttccaggagctgctgaagctgctggatgaggtcatgtgt
cttcagacatcagtgtggtgccagatttacaatatcattccatggataatgaaattcctt
cctggaccccaccaaaccctcttcagtaattgggagaaactgaaaatgtttgttgcccat
gtgattgaaaaccacaggagagactggaatcctgctgaagcaagagacttcattgaggct
tacctccaggaaatagaaaagcataagggtgatgctacttcaagtttccaagaagaaaac
ctcatctgtagcaccctggacctcttcgttgctggaactgagaccacgtcaacaacactg
cgctggggtctgctgtacatggccctgtaccctgaaatccaagagaaagtccaagctgag
attgacagggtgcttggccaattacagcagccgagcacagcagctcgagagtccatgccc
tacaccaacgccgtcatccatgaggtgcagagaatgggcaacatcatccccctgaacgtg
ccccgggaggtggcagaggataccaccctggctggataccacctgcccaaggggacgatg
gtcatagccaatctgactgcactacatagcgaccccacagagtgggccaccccagacaca
ttcaatccagagcattttctggagaatggaaagtttaagaaaagggaagcctttctgcct
ttctcagtagggaagcgggcgtgccttggagagcagctggccaggactgagctgttcgtt
ttctttacttcccttttacaaaaattctccttcaggcctccagacaatgagaagctgagc
ctcaagttcagaatgggcctgaccctctccccagtcacctaccgcatctgtgcagttccc
agggcatga

DBGET integrated database retrieval system